You Searched For: 5-Hydroxy-2-nitrobenzaldehyde


2,170  results were found

SearchResultCount:"2170"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103002-836)
Supplier: Anaspec Inc
Description: This pro-apoptotic peptide, also called (klaklak)2, is a programmed cell-death inducing peptide, non toxic outside cells, but toxic once internalized, as it disrupts mitochondiral membranes. It is linked to a targeting domain (NGR), which drives the peptide to target cells and allows its internalization. It contains the Asn-Gly-Arg (NGR) motif which was shown to allow the delivery of anti-tumor compounds to tumor vessels.
Sequence:CNGRCGGklaklakklaklak-NH2 (Disulfide bridge: 1-5)
MW:2168.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: TCI America
Description: Sulbutiamine, Purity: >98.0%(HPLC)(T), Cas number: 3286-46-2, Molecular Formula: C32H46N8O6S2, Molecular Weight: 702.89, Synonyms: Bisibuthiamine, O-Isobutyroylthiamine Disulfide, Appearance: White - Almost white solid crystal powder, Size: 25G

SDS

Supplier: Peprotech
Description: Resistin belongs to a family of tissue-specific cytokines termed FIZZ (found in inflammatory zones) and RELM. The four known members of this family, resistin, RELMα, RELMβ, and RELMγ, share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Resistin is an adipose-derived cytokine (adipokine) whose physiological function and molecular targets are largely unknown. Studies have shown that resistin suppresses insulin's ability to stimulate glucose uptake, and postulated that resistin might be an important link between obesity and Type 2 diabetes. Other studies have indicated that resistin expression is severely suppressed in obesity, and that it may act as a feedback regulator of Adipogenesis. Recombinant Rat Resistin is a 20.0 kDa, disulfide-linked, homodimeric protein composed of two 94 identical amino acid chains linked by a single disulfide bond.

Supplier: Peprotech
Description: Artemin is a disulfide-linked homodimeric neurotrophic factor structurally related to GDNF, Artemin, Neurturin and Persephin. These proteins belong to the cysteine knot superfamily of growth factors that assume stable dimeric protein structures. Artemin, GDNF, Persephin and Neurturin all signal through a multicomponent receptor system, composed of RET (receptor tyrosine kinase) and one of the four GFRα (α1-α4) receptors. Artemin prefers the receptor GFRα3-RET, but will use other receptors as an alternative. Artemin supports the survival of all peripheral ganglia, such as sympathetic, neural crest and placodally-derived sensory neurons, and dopaminergic midbrain neurons. The functional human Artemin ligand is a disulfide-linked homodimer of two 12.0 kDa polypeptide monomers. Each monomer contains seven conserved cysteine residues, one of which is used for interchain disulfide bridging and the others are involved in intramolecular ring formation known as the cysteine knot configuration. Recombinant Human Artemin is a 24.2 kDa, disulfide-linked homodimer formed by two identical 113 amino acid subunits.

Catalog Number: (103008-242)
Supplier: Anaspec Inc
Description: This is a biotinylated CGRP with a long chain linker attached at the N-terminus end.
Sequence:Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:4128.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: ET-1 is a potent vasoconstrictor peptide derived from endothelial cells. It plays a role in regulation of cardiovascular functions
Sequence:CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2492 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (H-8420.1000BA)
Supplier: Bachem Americas
Description: CNP, a member of the natriuretic peptide family, was first identified in porcine brain and later found in other mammals as well as non-mammals. Processing of the CNP precursor gives rise to CNP-22 and its N-terminally elongated form, CNP-53. The CNPs share considerable sequence homology with ANP and BNP within the disulfide loop and exert similar pharmacological actions, although with different relative potencies. CNP-22 is a potent and selective activator of the human BNP cell surface receptor, a transmembrane guanylyl cyclase. This ligand-receptor pair may be involved in the regulation of fluid homeostasis by the central nervous system.


Supplier: Peprotech
Description: GDF-3 is a member of the TGF-β superfamily of growth and differentiation factors, and is highly homologous to GDF-9. Unlike most TGF-β family members, GDF-3 and GDF-9 are not disulfide-linked dimers. GDF-3 is expressed in adult bone marrow, spleen, thymus, and adipose tissue. The expression of GDF-3 is upregulated in high-fat-fed wild-type FABP4/aP2 null mice and was associated with obesity, but not with the related hyperglycemia/hyperinsulinemia that characterizes Type 2 diabetes. Recombinant Human GDF-3 is a 26.0 kDa non-disulfide-linked homodimer containing two 114 amino acid polypeptide chains.

Supplier: Peprotech
Description: Neurturin is a disulfide-linked homodimer neurotrophic factor structurally related to GDNF, artemin, and persephin. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Neurturin signals through a multicomponent receptor system, composed of RET and one of four GFRα (α1-α4) receptors. Neurturin promotes the development and survival of sympathetic and sensory neurons by signaling through a receptor system composed of RET and GFRα2. The functional form of human neurturin is a disulfide-linked homodimer, of two 11.8 kDa polypeptide monomers (204 total amino acid residues). Each monomer contains seven conserved cysteine residues, one of which (Cys 69) is used for inter-chain disulfide bridging, and the others are involved in the intramolecular ring formation known as the cysteine knot configuration.

Supplier: Peprotech
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional human GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Human GDNF is 30.4 kDa.

Supplier: Peprotech
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional rat GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Rat GDNF is 30.0 kDa.

Catalog Number: (103007-818)
Supplier: Anaspec Inc
Description: This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.
Sequence:TKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
MW:3019.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-472)
Supplier: Anaspec Inc
Description: This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
MW:2155.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (10103-904)
Supplier: Prosci
Description: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins (Hayano and Kikuchi, 1995 [PubMed 7590364]).


Catalog Number: (103005-970)
Supplier: Anaspec Inc
Description: A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-332)
Supplier: Anaspec Inc
Description: Bactenecin is a 12-amino acid cationic antimicrobial peptide from bovine neutrophils.
Sequence:RLCRIVVIRVCR (Disulfide bridge: 3-11)
MW:1483.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
481 - 496 of 2,170
no targeter for Bottom