Print…

You Searched For: 6-Chloro-2-fluoronicotinic+acid


2,575  results were found

Refine Results Sort by
SearchResultCount:"2575"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCA0947-025G

5-Aminoorotic acid ≥97.0% (by total nitrogen and titration analysis)

Catalog Number: (TCA0947-025G)
Supplier: TCI America
Description: CAS Number: 7164-43-4
MDL Number: MFCD00010563
Molecular Formula: C5H5N3O4
Molecular Weight: 171.11
Purity/Analysis Method: >97.0% (N,T)
Form: Crystal

SDS Certificates


Image Unavailable-TCE1267-50MG

Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate ≥97.0% (by HPLC)

Catalog Number: (TCE1267-50MG)
Supplier: TCI America
Description: Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate, Purity: >97.0%(HPLC), CAS number: 1678540-23-2, MF: C54H63NO2, Molecular Weight: 758.1, Size: 50 MG
Product Image-76702-466

Dog Ubiquitin Carboxyl-terminal Hydrolase Isozyme L1(UCHL1) ELISA Kit

Catalog Number: (76702-466)
Supplier: AFG Bioscience
Description: Dog Ubiquitin Carboxyl-terminal Hydrolase Isozyme L1(UCHL1) ELISA Kit
Image Unavailable-CA1.04595.0025

Patton-reeders reagent (Calconcarboxylic acid dihydrate) indicator for metal titration, Supelco®

Supplier: MilliporeSigma

Certificates

Image Unavailable-103009-388

Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-76712-668

Human Pyrroline 5 Carboxylate Reductase 3 (PYCRL) ELISA Kit

Catalog Number: (76712-668)
Supplier: AFG Bioscience
Description: Human Pyrroline 5 Carboxylate Reductase 3 (PYCRL) ELISA Kit
Product Image-CAMK6215-06

Methyl-4-hydroxybenzoate 98.0-102.0%, GenAR® NF, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Methyl-4-hydroxybenzoate ≥98%, GenAR® NF, Macron Fine Chemicals™

SDS Certificates

Image Unavailable-TCB4578-5G

2-Bromo-4-thiazolecarboxylic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 5198-88-9
MDL Number: MFCD04115729
Molecular Formula: C4H2BrNO2S
Molecular Weight: 208.03
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 217
Lambda max.: 243 nm (MeOH)

SDS

Image Unavailable-CAAAA18594-30

Orotic acid monohydrate 98%

Supplier: Thermo Scientific Chemicals
Description: Orotic acid monohydrate 98%

Certificates

Image Unavailable-TCE1110-5G

Ethyl-4,6-dihydroxynicotinate ≥97.0% (by titrimetric analysis)

Supplier: TCI America
Description: Ethyl 4,6-Dihydroxynicotinate, Purity: >97.0%(T), Cas no: 6975-44-6, MF: C8H9NO4, MW: 183.16, Synonyms: 4,6-Dihydroxynicotinic Acid Ethyl Ester, 4,6-Dihydroxypyridine-3-carboxylic Acid Ethyl Ester, Ethyl 4,6-Dihydroxypyridine-3-carboxylate, Size: 1G

Image Unavailable-CAAAH60414-03

3-Oxocyclopentanecarboxylic acid 97%

Catalog Number: (CAAAH60414-03)
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-TCE1146-5G

Ethyl-2-aminonicotinate ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: Ethyl 2-Aminonicotinate, Purity: >98%(GC)(T), CAS: 13362-26-0, MF: C8H10N2O2, MW: 166.18, Synonym: 2-Aminonicotinic Acid Ethyl Ester, 2-Aminopyridine-3-carboxylic Acid Ethyl Ester, Ethyl 2-Aminopyridine-3-carboxylate, Physical state: Solid, Form: Crystal- Powder, Size: 1G

SDS

Image Unavailable-A-3850.0001BA

N-(tert-Butoxycarbonyl)-L-pyroglutamic acid

Supplier: Bachem Americas
Description: Sequence: Boc-Pyr-OH

Image Unavailable-AAH34258-03

3-Chloro-5-(trifluoromethyl)picolinic acid 97%

Catalog Number: (AAH34258-03)
Supplier: Thermo Scientific Chemicals
Description: 3-Chloro-5-(trifluoromethyl)pyridine-2-carboxylic acid, Purity: 97%, Cas Number: 80194-68-9, Molecular Formula: C7H3ClF3NO2, Color: White to cream, Form: Solid, Synonyms: 3-Chloro-5-(trifluoromethyl)picolinic acid, Size: 1g

SDS Certificates


Image Unavailable-TCP0459-025G

Piperonylic acid ≥98.0% (by GC, titration analysis)

Catalog Number: (TCP0459-025G)
Supplier: TCI America
Description: CAS Number: 94-53-1
MDL Number: MFCD00005830
Molecular Formula: C8H6O4
Molecular Weight: 166.13
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 230

SDS Certificates


Product Image-76707-392

Human Ubiquitin Carboxyl-terminal Hydrolase Isozyme L1(UCHL1) ELISA Kit

Catalog Number: (76707-392)
Supplier: AFG Bioscience
Description: Human Ubiquitin Carboxyl-terminal Hydrolase Isozyme L1(UCHL1) ELISA Kit
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
593 - 608 of 2,575
no targeter for Bottom