You Searched For: 3,6-Dibromocarbazole


1,540  results were found

SearchResultCount:"1540"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: [Spectrophotometric Reagent for B]
CAS Number: 5941-07-1
MDL Number: MFCD00042050
Molecular Formula: C17H13NO8S2
Molecular Weight: 445.39
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Supplier: MCR Safety
Description: Whether working in the rugged oil and gas industry or spending the day working near electrical hazards, stay safe and comfortable in MCR Safety's Flame Resistant (FR) Gear made with Max Comfort™ fabrics.

UL Listed

Catalog Number: (89049-980)
Supplier: Sonoco Thermosafe
Description: These semi-rigid foam bricks never change shape during freezing, thawing or transit, enabling superior surface contact for more consistent temperature control.


Catalog Number: (10082-328)
Supplier: Proteintech
Description: BEND4, also named as CCDC4, has 5 isoforms with MW 55-58 kDa, 45-48 kDa and 36 kDa.


Catalog Number: (470302-412)
Supplier: Ward's Science
Description: Shelf Life (months): 36<BR>Storage: Red<BR><BR>Please Note: This product is designed for educational and teaching laboratories and no certificate of analysis is available.

SDS


Catalog Number: (470177-964)
Supplier: Allied K & R
Description: The long handle and fan tip is ideal for cleaning 50 mL burets. Size: 36"L; brush size: 3/4" dia. x 3"L. Package of 12.


Catalog Number: (10053-174)
Supplier: Thermco
Description: Precison ASTM plain form hydrometers made to meet ASTM and API specifications, which do not incorporate a thermometer in the hydrometer


Catalog Number: (102999-326)
Supplier: Anaspec Inc
Description: In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4111.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Bausch & Lomb
Description: A swing-away case of durable plastic serves both as a handle and protective case.

Catalog Number: (CA80602-840)
Supplier: MilliporeSigma
Description: Recognizes the ~146 kDa GAPDH protein under non-reducing conditions and the ~36 kDa monomeric subunits under reducing conditions.

Catalog Number: (470302-414)
Supplier: Ward's Science
Description: Formula Weight: Mixture
Formula: Mixture
Density (g/mL): 1.04
Shelf Life (months): 36
Storage: Green

SDS


Catalog Number: (470303-054)
Supplier: Ward's Science
Description: CAS Number: Mixture
Formula Weight: Mixture
Formula: Mixture
Shelf Life (months): 36
Storage: Green

SDS


Supplier: Bachem Americas
Description: Sequence: Pyr-AMC

Supplier: Ward's Science
Description: CAS Number: 8005-03-6
Solubility: Water
Synonyms: Acid Black 2
Shelf Life (months): 36
Storage: Green

SDS

Supplier: Micronova
Description: This high temperature tape is constructed of transparent amber polyimide film with pressure sensitive silicone adhesive on a plastic core

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier: Ward's Science
Description: Specimen Holding Fluid, Dilute one part to nine parts water for use.
Shelf Life (months): 36
Storage: Red

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,201 - 1,216 of 1,540
no targeter for Bottom