Print…

You Searched For: 3,8-Diamino-6-phenylphenanthridine


3,948  results were found

Refine Results Sort by
SearchResultCount:"3948"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCD2634-005G

2,5-Diamino-4,6-dihydroxypyrimidine hydrochloride ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 56830-58-1
MDL Number: MFCD00082893
Molecular Formula: C4H6N4O2
Molecular Weight: 178.58
Purity/Analysis Method: >98.0% (T,HPLC)
Form: Crystal

SDS

Image Unavailable-TCB4062-25MG

N-(1R,8S,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane ≥90.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 1263166-93-3
MDL Number: MFCD19705418
Molecular Formula: C17H28N2O4
Molecular Weight: 324.42
Purity/Analysis Method: >90.0% (HPLC)
Form: Clear Liquid
Storage Temperature: >-20°C

SDS

Image Unavailable-H-5758.1000BA

Chicken;Human;Mouse;Pig;Rat;Sheep PACAP-38 (28-38) Trifluoroacetate

Supplier: Bachem Americas
Description: PACAP-38 (28-38) (HUMAN, CHICKEN) 0.5mg CAS: 160489-86-1 C61H110N24O14 FW: 1403.7. Synonym: Pituitary Adenylate Cyclase Activating Polypeptide-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)

Image Unavailable-102998-430

Human ACTH (7-38)

Catalog Number: (102998-430)
Supplier: Anaspec Inc
Description: Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Sequence: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
MW: 3659.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-TCB1724-025G

3,9-Bis[2-(3,5-diamino-2,4,6-triazaphenyl)ethyl]-2,4,8,10-tetraoxaspiro[5.5]undecane ≥98.0% (by titrimetric analysis)

Catalog Number: (TCB1724-025G)
Supplier: TCI America
Description: CAS Number: 22535-90-6
MDL Number: MFCD00191395
Molecular Formula: C17H26N10O4
Molecular Weight: 434.46
Purity/Analysis Method: >98.0% (T)
Form: Crystal

SDS


Product Image-76738-096

Mouse PACAP-38 ELISA Kit

Catalog Number: (76738-096)
Supplier: Antibodies.com
Description: Mouse PACAP-38 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse PACAP-38 in serum, plasma, tissue homogenates, and other biological fluids.
Product Image-76577-960

Human Interleukin-38 (IL-38) ELISA Kit, AFG Bioscience

Catalog Number: (76577-960)
Supplier: AFG Bioscience
Description: Human Interleukin-38 (IL-38) ELISA Kit, AFG Bioscience
Image Unavailable-76963-460

Anti-IPO-38 Mouse Monoclonal Antibody [clone: IPO-38]

Catalog Number: (76963-460)
Supplier: ANTIBODIES.COM LLC
Description: Anti-IPO-38 Mouse Monoclonal Antibody [clone: IPO-38]
Image Unavailable-H-2966.0500BA

beta-Amyloid (1-38) Trifluoroacetate

Supplier: Bachem Americas
Description: Like Aβ (25-35) (H-1192), the Aβ fragment (1-38) destabilizes calcium homeostasis and renders human cortical neurones vulnerable to environmental insults.

Image Unavailable-H-5484.0500BA

Chicken;Human;Mouse;Pig;Rat;Sheep PACAP-38 (16-38) Trifluoroacetate

Catalog Number: (H-5484.0500BA)
Supplier: Bachem Americas
Description: This C-terminal fragment of PACAP-38 is very effective in inducing histamine release from rat peritoneal mast cells.
Product Image-76957-130

Anti-IPO-38 Mouse Monoclonal Antibody [clone: IPO-38]

Catalog Number: (76957-130)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [IPO-38] antibody to IPO-38 for IHC-P with samples derived from Human, Mouse and Rat.
Product Image-CAMK251546

Hydrochloric acid 36.5 - 38%, GenAR® NF, Macron Fine Chemicals™

Catalog Number: (CAMK251546)
Supplier: VWR International
Description: Hydrochloric acid 36,5 - 38%, GenAR® NF, Macron Fine Chemicals™

Certificates


Product Image-76704-758

Rat Interleukin 38 (IL-38) ELISA Kit

Catalog Number: (76704-758)
Supplier: AFG Bioscience
Description: Rat Interleukin 38 (IL-38) ELISA Kit
Image Unavailable-75955-206

Anti-IPO-38 Mouse Monoclonal Antibody [clone: IPO-38]

Supplier: Biotium
Description: This antibody recognizes a protein of 14-16 kDa, which is a novel nuclear antigen of proliferating cells. IPO-38 antigen is present in the nuclei of proliferating cells such as Hodgkins disease and non-Hodgkins lymphomas, different forms of leukemias, breast and colorectal carcinomas, and PHA-stimulated lymphocytes. It is not expressed in the cells of non-stimulated lymphocytes and granulocytes. IPO-38 may be a useful marker of cell proliferation during monitoring of tumor progression.

Product Image-CAJT0791-9

Ammonium sulfate 38% (w/w) in aqueous solution, BAKER ANALYZED®, J.T.Baker®

Catalog Number: (CAJT0791-9)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Ammonium sulfate 38% (w/w) in aqueous solution, BAKER ANALYZED®, J.T.Baker®

Certificates


Image Unavailable-CA80501-478

Anti-CD11a Mouse Monoclonal Antibody [clone: 38]

Catalog Number: (CA80501-478)
Supplier: MilliporeSigma
Description: Primary Mouse Anti-CD11a (38) Reacts with Human

Certificates


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
65 - 80 of 3,948
no targeter for Bottom