You Searched For: 3,4-Methylenedioxycinnamic+acid


68,881  results were found

SearchResultCount:"68881"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: Verbascoside, Purity/Analysis Method: >97.0%(HPLC), CAS Number: 61276-17-3, Molecular Formula: C29H36O15, Molecular Weight: 624.59, Synonym: Kusaginin, Size: 50MG

Catalog Number: (77514-840)
Supplier: AFG Bioscience
Description: Mouse CD34 (Cluster Of Differentiation 34) ELISA Kit


Supplier: TCI America
Description: CAS Number: 18278-34-7
MDL Number: MFCD00051964
Molecular Formula: C8H8O3
Molecular Weight: 152.15
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 158
Catalog Number: (103006-992)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Enzo Life Sciences
Description: AGT inhibitor

Catalog Number: (76630-056)
Supplier: Prosci
Description: Anti-V alpha TCR Recombinant Antibody [Clone: 34]


Catalog Number: (TCT1520-100MG)
Supplier: TCI America
Description: [e.e. Determination Reagent by NMR]
CAS Number: 53531-34-3
MDL Number: MFCD00001260
Molecular Formula: C16H11F3O
Molecular Weight: 276.26
Purity/Analysis Method: >99.0% (GC)
Form: Crystal
Color: Slightly Pale Yellow
Melting point (°C): 134
Specific rotation [a]20/D: -30.5 deg (C=1, CHCl3)

SDS


Supplier: Thermo Scientific Chemicals
Description: 7-Nitro-1-tetralone 97%
Supplier: Thermo Scientific Chemicals
Description: An apoptosis inducer
Supplier: TCI America
Description: CAS Number: 18282-59-2
MDL Number: MFCD00040849
Molecular Formula: C6H3BrCl2
Molecular Weight: 225.89
Purity/Analysis Method: >98.0% (GC)
Form: Lump
Boiling point (°C): 124
Flash Point (°C): 87
Freezing point (°C): 23
Supplier: TCI America
Description: CAS Number: 42490-26-6
Molecular Formula: C18H12S
Molecular Weight: 260.35
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 268

SDS

Catalog Number: (TCI0630-100MG)
Supplier: TCI America
Description: CAS Number: 41546-34-3
MDL Number: MFCD01321249
Molecular Formula: C6H12O6
Molecular Weight: 180.16
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 286
Storage Temperature: <0°C

Supplier: TCI America
Description: CAS Number: 15862-34-7
Molecular Formula: C5H3BrN2O3
Molecular Weight: 218.99
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 247

SDS

Catalog Number: (76630-876)
Supplier: Prosci
Description: Anti-V alpha TCR Recombinant Antibody [Clone: 34]


Catalog Number: (77514-838)
Supplier: AFG Bioscience
Description: Human CD34 (Cluster Of Differentiation 34) ELISA Kit


Supplier: TCI America
Description: CAS Number: 3034-34-2
MDL Number: MFCD00017133
Molecular Formula: C8H6N2O
Molecular Weight: 146.15
Purity/Analysis Method: >97.0% (N)
Form: Crystal
Melting point (°C): 226

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
977 - 992 of 68,881
no targeter for Bottom