You Searched For: 3,4-Dibromothiophene


4,477  results were found

SearchResultCount:"4477"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00040849 Beilstein Registry No.: 1635735
Catalog Number: (103368-366)
Supplier: Novus Biologicals
Description: The Tubulin Antibody (YOL1 / 34) [DyLight 350] from Novus Biologicals is a rat monoclonal antibody to Tubulin. This antibody reacts with human, mouse, rat, drosophila, fungi, yeast. The Tubulin Antibody (YOL1 / 34) [DyLight 350] has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Frozen.


Supplier: TCI America
Description: Verbascoside, Purity/Analysis Method: >97.0%(HPLC), CAS Number: 61276-17-3, Molecular Formula: C29H36O15, Molecular Weight: 624.59, Synonym: Kusaginin, Size: 50MG

Catalog Number: (89278-362)
Supplier: Genetex
Description: Mouse monoclonal antibody [NA1/34-HLK] to CD1a


Supplier: TCI America
Description: CAS Number: 32653-34-2
MDL Number: MFCD00191403
Molecular Formula: C6H11ClO2
Molecular Weight: 150.60
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 125
Specific Gravity (20/20): 1.12
Specific rotation [a]20/D: -4.5 deg (neat)

SDS

Catalog Number: (89262-726)
Supplier: Genetex
Description: Mouse monoclonal antibody [OX-34] to CD2


Supplier: TCI America
Description: CAS Number: 446-34-4
MDL Number: MFCD00007053
Molecular Formula: C7H6FNO2
Molecular Weight: 155.13
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 98
Melting point (°C): 54
Flash Point (°C): 110

SDS

Catalog Number: (TCT1520-100MG)
Supplier: TCI America
Description: [e.e. Determination Reagent by NMR]
CAS Number: 53531-34-3
MDL Number: MFCD00001260
Molecular Formula: C16H11F3O
Molecular Weight: 276.26
Purity/Analysis Method: >99.0% (GC)
Form: Crystal
Color: Slightly Pale Yellow
Melting point (°C): 134
Specific rotation [a]20/D: -30.5 deg (C=1, CHCl3)

SDS


Supplier: TCI America
Description: CAS Number: 15119-34-3
MDL Number: MFCD00115699
Molecular Formula: C10H5NO2
Molecular Weight: 171.16
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 186
Lambda max.: 358 nm (DMSO)

SDS

Catalog Number: (103006-992)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Thermo Scientific Chemicals
Description: An apoptosis inducer
Supplier: Abcam
Description: Rabbit monoclonal [EPR26957-34] to TRIM46.

New Product

Catalog Number: (89365-702)
Supplier: Genetex
Description: Mouse monoclonal [MRC OX-34] to rat CD2


Supplier: TCI America
Description: CAS Number: 611-34-7 MDL Number: MFCD00006797 Molecular Formula: C9H8N2 Molecular Weight: 144.18 Purity/Analysis Method: <gt/>99.0% (T) Form: Crystal Boiling point (°C): 310 Melting point (°C): 109
Supplier: Thermo Scientific Chemicals
Description: A neurotransmitter and vasopressor that modulates cortical activation
Supplier: TCI America
Description: CAS Number: 3388-04-3
MDL Number: MFCD00014485
Molecular Formula: C11H22O4Si
Molecular Weight: 246.38
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 310
Flash Point (°C): 141
Specific Gravity (20/20): 1.07
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
609 - 624 of 4,477
no targeter for Bottom