Print…

You Searched For: 3,4-Diacetoxybenzaldehyde


4,473  results were found

Refine Results Sort by
SearchResultCount:"4473"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-ABCA_AB313063-100U

Anti-UCP1 Rabbit Monoclonal Antibody [clone: EPR23004-34] (Alexa Fluor® 568)

Catalog Number: (ABCA_AB313063-100U)
Supplier: Abcam
Description: Alexa Fluor® 568 Rabbit monoclonal [EPR23004-34] to UCP1.

New Product


Image Unavailable-103007-174

Human GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34)

Catalog Number: (103007-174)
Supplier: Anaspec Inc
Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102996-410

Human Parathyroid Hormone (1-34)-Lys(Biotin), Biotin

Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-TCC2832-5G

(S)-6-Chloro-4-hydroxy-3,4-dihydro-2H-thieno[3,2-e][1,2]thiazine-1,1-dioxide ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 160982-16-1
MDL Number: MFCD09033311
Molecular Formula: C6H6ClNO3S2
Molecular Weight: 239.69
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 130
Specific rotation [a]20/D: -5 deg (C=1, MeOH)

SDS

Product Image-89152-554

Cyclothiazide

Catalog Number: (89152-554)
Supplier: Enzo Life Sciences
Description: AMPA receptor activator
Image Unavailable-102885-924

Anti-IL34 Rat Monoclonal Antibody [clone: 780310]

Catalog Number: (102885-924)
Supplier: R&D Systems
Description: Mouse IL-34 Monoclonal antibody (Clone 780310), Isotype: Rat IgG2A, Immunogen: myeloma cell line NS0-derived recombinant, Application: Neutralization, 500UG
Image Unavailable-CA10760-952

Anti-IL-34 Mouse Monoclonal Antibody (Biotin) [clone: E033B8]

Supplier: Biolegend
Description: Biotin anti-human IL-34 [E033B8]; Isotype: Mouse IgG2a, λ; Reactivity: Human; Apps: ELISA Detection; Size: 500 μg

Image Unavailable-102879-140

Anti-IL34 Mouse Monoclonal Antibody (Biotin) [clone: 578401]

Catalog Number: (102879-140)
Supplier: R&D Systems
Description: Human IL-34 Biotinylated Monoclonal Antibody (Clone 578401), Mouse IgG1, ELISA(Det), Species Reactivity:Human, Label:Biotin, Immunogen:Mouse myeloma cell line NS0-derived recombinant human IL-34. Asn21-Pro242 Accession Number NP-689669
Image Unavailable-TCT3134-1G

Triethoxy(pentafluorophenyl)silane ≥95.0% (by GC)

Supplier: TCI America
Description: Triethoxy(pentafluorophenyl)silane, Purity/Analysis Method: >95.0%(GC), CAS Number: 20083-34-5, Molecular formula: C12H15F5O3Si, Molecular weight: 330.33, Size: 5G

Certificates

Product Image-CA422903-BL

Rainbow Calibration Particles, 8 peaks (3.0-3.4 μM), BioLegend

Catalog Number: (CA422903-BL)
Supplier: Biolegend
Description: Rainbow Calibration Particles, 8 peaks (3.0-3.4 UM); Apps: FC
Image Unavailable-CAAAA11934-06

4-Bromo-1,2-difluorobenzene 98+%

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00000304 Beilstein Registry No.: 1934811

Certificates

Product Image-89044-788

Accessories for Socorex™ Calibrex™ 521 digital Bottle Top Dispensers, DWK Life Sciences

Catalog Number: (89044-788)
Supplier: DWK Life Sciences (KIMBLE)
Description: threaded, 34 mm OD

Small Business Enterprise


Image Unavailable-TCP1818-1G

Potassium(2-methylphenyl)trifluoroborate ≥98.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 274257-34-0
MDL Number: MFCD03790006
Molecular Formula: C7H7BF3K
Molecular Weight: 198.04
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 226

SDS

Product Image-80067-974

Drying Towers, Chemglass

Supplier: Chemglass
Description: Cylindrical shaped drying tower has a 34/28 ground glass stopper.

Small Business Enterprise

Product Image-ABCA_AB195884-100U

Anti-Tubulin (acetyl K40) Rat Monoclonal Antibody [clone: YOL1/34] (Alexa Fluor® 647)

Catalog Number: (ABCA_AB195884-100U)
Supplier: Abcam
Description: Alexa Fluor® 647 Rat monoclonal [YOL1/34] to Tubulin - Microtubule Marker.

New Product


Image Unavailable-TCT1943-5G

2,3,5,6-Tetrafluoro-4-hydroxybenzoic acid ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 652-34-6
MDL Number: MFCD00129952
Molecular Formula: C7H2F4O3
Molecular Weight: 210.08
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 154

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
737 - 752 of 4,473
no targeter for Bottom