Print…

You Searched For: 3,4-Diacetoxybenzaldehyde


4,483  results were found

Refine Results Sort by
SearchResultCount:"4483"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-ABCA_AB197070-100U

Anti-MEF2A+MEF2C Rabbit Monoclonal Antibody [clone: EPR19089-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR19089-34] to MEF2A + MEF2C.

New Product

Image Unavailable-TCF0831-5G

6-Fluoro-4-chromanone ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 66892-34-0
MDL Number: MFCD00038654
Molecular Formula: C9H7FO2
Molecular Weight: 166.15
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 116

SDS

Image Unavailable-ABCA_AB212059-100U

Anti-E Cadherin Rabbit Monoclonal Antibody [clone: EPR16845-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR16845-34] to E Cadherin.

New Product

Image Unavailable-TCA2523-100MG

Biotin-PEG3-azide ≥95.0% (by HPLC)

Catalog Number: (TCA2523-100MG)
Supplier: TCI America
Description: CAS Number: 875770-34-6
MDL Number: MFCD20134145
Molecular Formula: C18H32N6O5S
Molecular Weight: 444.55
Purity/Analysis Method: >95.0% (HPLC)
Form: Crystal
Melting point (°C): 110
Storage Temperature: <0°C

SDS Certificates


Image Unavailable-H-6686.1000BA

Human;Mouse;Rat Adropin (34-76) Trifluoroacetate

Supplier: Bachem Americas
Description: Adropin is a secreted factor involved in energy homeostasis and lipid metabolism. It is encoded by the energy homeostasis associated gene (Enho) and is expressed in liver and brain. In diet-induced obesity (DIO) mice Adropin (34-76) attenuated hepatosteatosis and insulin reistance independently of adiposity or food intake. Additionally, adropin could be a regulator of endothelial function.

SDS

Image Unavailable-89365-698

Anti-CD2 Mouse Monoclonal Antibody [clone: MRC OX-34]

Catalog Number: (89365-698)
Supplier: Genetex
Description: Mouse monoclonal [MRC OX-34] to rat CD2 (Biotin)
Image Unavailable-CAAAA17257-06

3',4'-Difluoropropiophenone 97%

Catalog Number: (CAAAA17257-06)
Supplier: Thermo Scientific Chemicals
Description: 3',4'-Difluoropropiophenone 97%

Certificates


Image Unavailable-CAAAA11110-22

Veratraldehyde 99%

Supplier: Thermo Scientific Chemicals
Description: Veratraldehyde 99%

Certificates

Image Unavailable-89278-362

Anti-CD1A Mouse Monoclonal Antibody (FITC (Fluorescein Isothiocyanate)) [clone: NA1/34-HLK]

Catalog Number: (89278-362)
Supplier: Genetex
Description: Mouse monoclonal antibody [NA1/34-HLK] to CD1a
Image Unavailable-TCH1512-1G

4'-Hydroxyacetophenone oxime ≥98.0% (by GC)

Supplier: TCI America
Description: 4'-Hydroxyacetophenone Oxime, Purity: >98.0%(GC), CAS Number: 34523-34-7, Molecular Formula: C8H9NO2, Molecular Weight: 151.17, Physical state: Solid, Form: Crystal - Powder, Colour: White - Pale yellow, Size: 5G

SDS

Image Unavailable-TCD3436-5G

2,5-Difluorophenylboronic acid (contains varying amounts of Anhydride)

Supplier: TCI America
Description: CAS Number: 193353-34-3
MDL Number: MFCD01863171
Molecular Formula: C6H5BF2O2
Molecular Weight: 157.91
Form: Crystal
Color: White
Melting point (°C): 110

SDS

Image Unavailable-TCP2088-25MG

Phenethyl caffeate ≥98.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 104594-70-9
MDL Number: MFCD00866470
Molecular Formula: C17H16O4
Molecular Weight: 284.31
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 129
Lambda max.: 323 nmStorage Temperature: <0°C

SDS

Image Unavailable-103006-992

Human Beta-Amyloid (1-34)

Catalog Number: (103006-992)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-TCI0948-5G

Itopride hydrochloride ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: Itopride Hydrochloride, Purity: >98.0%(HPLC)(T), CAS number: 122892-31-3, Molecular Formula: C20H26N2O4.HCl, Molecular Weight: 394.9, Synonym: N-[4-[2-(Dimethylamino)ethoxy]benzyl]-3,4-dimethoxybenzamide Hydrochloride, Size: 1G

Image Unavailable-TCT2787-25G

2,2'-[4-(2-Hydroxyethylamino)-3-nitrophenylimino]diethanol ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 33229-34-4
MDL Number: MFCD00071762
Molecular Formula: C12H19N3O5
Molecular Weight: 285.30
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Color: Yellow
Melting point (°C): 108

SDS

Image Unavailable-CA10760-844

Anti-IL-34 Mouse Monoclonal Antibody [clone: E0320E7]

Catalog Number: (CA10760-844)
Supplier: Biolegend
Description: Purified anti-human IL-34 [E0320E7]; Isotype: Mouse IgG2b, λ; Reactivity: Human; Apps: ELISA Capture; Size: 500 μg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
657 - 672 of 4,483
no targeter for Bottom