You Searched For: 3,3\\\'-Dimethylbiphenyl

4,425 results were found

Refine Results Sort by

Sort Results

List View Easy View

Compare(0) Clear

Rate These Search Results

Mouse Recombinant IL-33 (from E. coli)

Supplier: VWR International

Description: Interleukin 33 (IL-33) is a member of the IL-1 cytokine family and is constitutively expressed in smooth muscle and airway epithelial cells. IL-33 signals through the interleukin 1 receptor-like 1 (IL-1R1) and interleukin-1 receptor accessory protein (IL1RAP) receptors to ativate NF-κB and MAPK signaling pathways. IL-33 functions to induce type 2 cytokine production in polarized Type 2 helper T (Th2) cells.

New Product

Human Recombinant IL-33 (from E. coli)

Supplier: Adipogen

(2R,2'R)-3,3'-Disulfanediylbis(2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)propanoic acid)

Supplier: Bachem Americas

Description: Sequence: (Fmoc-Cys-OH)₂

Human Recombinant IL-33 (from E. coli)

Supplier: Peprotech

Description: Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor, to activate NF-κB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Recombinant Human IL-33 is a 17.9 kDa protein containing 159 amino acid residues.

Human Beta-Amyloid (1-33)

Catalog Number: (103003-038)

Supplier: Anaspec Inc

Description: Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Molecular Weight: 3674 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Retrieving Each

Mouse Recombinant IL-33 (from E. coli)

Supplier: Peprotech

Description: IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor, to activate NF-κB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Recombinant Murine IL-33 is a 17.5 kDa protein containing 158 amino acid residues.

Human Recombinant IL-33 (from E. coli)

Supplier: Adipogen

Description: Interleukin-33 (IL-33; HF-NEV; IL-1F11), a member of the IL-1 family of cytokines, is expressed by many cell types following pro-inflammatory stimulation and is thought to be released upon cell lysis. IL-33 binds to and signals through ST2 (IL-1R1) and its stimulation recruits MYD88, IRAK, IRAK4 and TRAF6, followed by phosphorylation of ERK1 (MAPK3) / ERK2 (MAPK1), p38 (MAPK14) and JNK. The ability of IL-33 to target numerous immune cell types, like Th2-like cells, mast cells and B1 cells, and to induce cytokine and chemokine production underlines its potential in influencing the outcome of a wide range of diseases, such as arthritis, asthma, atopic allergy & anaphylaxis, cardiovascular disease/atherosclerosis, nervous system diseases and sepsis. IL-33 facilitates Treg expansion in vitro and in vivo. Recently, IL-33 has been involved in adipocyte differentiation. The biological activity of IL-33 at its receptor ST2 is rapidly terminated in the extracellular environment by its oxidation (formation of two disulfide bridges), resulting in an extensive conformational change that disrupts the ST2 binding site. Mutations at amino acids C208S/C232S protect IL-33 from oxidation and increase its activity.

(S)-(-)-2,2',6,6'-Tetramethoxy-4,4'-bis(di(3,5-xylyl)phosphino)-3,3'-bipyridine

Supplier: Thermo Scientific Chemicals

Description: Powder, packaged under argon

Certificates

Magnesium phosphate pentahydrate (33% P₂O₅)

Supplier: Thermo Scientific Chemicals

Description: Magnesium phosphate pentahydrate (33% P₂O₅)

Certificates

Human gp100 (25–33) peptide

Catalog Number: (103007-408)

Supplier: Anaspec Inc

Description: This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific, H-2Db-restricted, CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL
MW: 1155.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Retrieving Each

Human Cholecystokinin (26-33)

Catalog Number: (102996-106)

Supplier: Anaspec Inc

Description: C-terminal sulfated and amidated octapeptide Cholecystokinin (sulfated CCK-8) has the full biological action of the full-length 33-amino acid long Cholecystokinin (CCK). CCK acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
Sequence: D-Y(SO3H)-MGWMDF-NH2
MW: 1143.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Retrieving Each

(R)-(+)-2,2',6,6'-Tetramethoxy-4,4'-bis(di(3,5-xylyl)phosphino)-3,3'-bipyridine

Supplier: Thermo Scientific Chemicals

Description: Powder, packaged under argon

Certificates

Human Recombinant IL-33 (from E. coli)

Catalog Number: (76303-580)

Supplier: Peprotech

Description: Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor, to activate NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Recombinant Human IL-33 is a 17.9 kDa protein containing 159 amino acid residues.