Print…

You Searched For: 2-Amino-4,5-dimethylthiazole+hydrobromide


43,671  results were found

Refine Results Sort by
SearchResultCount:"43671"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAB21461-22

Pseudothiohydantoin 97%

Supplier: Thermo Scientific Chemicals
Description: Pseudothiohydantoin 97%

Certificates

Image Unavailable-TCA0923-005G

2-Amino-2-oxazoline hydrochloride ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 375855-07-5
MDL Number: MFCD00060178
Molecular Formula: C3H6N2O
Molecular Weight: 122.55
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 108

SDS Certificates

Image Unavailable-CAAAAL06476-18

1-Phenyl-4,5-dihydro-1H-pyrazol-3-ylamine ≥98%

Supplier: Thermo Scientific Chemicals
Description: 1-Phenyl-4,5-dihydro-1H-pyrazol-3-ylamine ≥98%

Image Unavailable-TCF0821-25G

Furazolidone ≥98.0% (by HPLC)

Catalog Number: (TCF0821-25G)
Supplier: TCI America
Description: CAS Number: 67-45-8
MDL Number: MFCD00910550
Molecular Formula: C8H7N3O5
Molecular Weight: 225.16
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 257
Lambda max.: 365 nm (DMSO)

SDS Certificates


Image Unavailable-TCD5092-5G

Dimethylammonium bromide ≥98.0% (by total nitrogen and titration analysis)

Supplier: TCI America
Description: Dimethylamine Hydrobromide, Purity: >98.0%(N)(T), Cas no: 6912-12-5, Molecular formula : C2H7N·HBr, Molecular weight : 126.00, Synonyms: Dimethylammonium Bromide, Size: 1G

Image Unavailable-103006-368

Rat Brain Natriuretic Peptide 45

Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-TCA1303-025G

2-Amino-4-methylthiazole ≥99.0%

Catalog Number: (TCA1303-025G)
Supplier: TCI America
Description: CAS Number: 1603-91-4
MDL Number: MFCD00005329
Molecular Formula: C4H6N2S
Molecular Weight: 114.17
Purity/Analysis Method: >99.0% (GC)
Form: Crystal
Boiling point (°C): 232
Melting point (°C): 45
Flash Point (°C): 110

SDS


Image Unavailable-TCA1816-1G

5-Amino-2-(trifluoromethyl)pyridine ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 106877-33-2
MDL Number: MFCD01862656
Molecular Formula: C6H5F3N2
Molecular Weight: 162.12
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 45
Flash Point (°C): 110

SDS

Image Unavailable-102971-866

Mouse BNP-45, AnaSpec

Catalog Number: (102971-866)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23 - 39)
MW:4919.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-TCE0182-100G

S-Ethylisothiouronium bromide ≥98.0% (by titrimetric analysis)

Catalog Number: (TCE0182-100G)
Supplier: TCI America
Description: CAS Number: 1071-37-0
MDL Number: MFCD00012585
Molecular Formula: C3H8N2S
Molecular Weight: 185.08
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 90

Certificates


Product Image-89150-790

Gardiquimod ≥98% (by HPLC and UV method)

Supplier: Enzo Life Sciences
Description: TLR7 ligand.

Image Unavailable-TCH0890-25G

4-Hexylaniline ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 33228-45-4
MDL Number: MFCD00007927
Molecular Formula: C12H19N
Molecular Weight: 177.29
Purity/Analysis Method: >98.0% (GC,T)
Form: Clear Liquid
Boiling point (°C): 285
Flash Point (°C): 113
Specific Gravity (20/20): 0.92
Storage Temperature: 0-10°C

SDS Certificates

Image Unavailable-E-2375.0100BA

L(+)-Serine

Supplier: Bachem Americas
Description: Sequence: H-Ser-OH

Image Unavailable-103009-726

Tau Peptide (45-73) (Exon 2/Insert 1 Domain)

Catalog Number: (103009-726)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE
MW:2977.97 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-TCF0718-5G

Fast green FCF ≥85.0% (by HPLC and UV method) for biochemical research

Catalog Number: (TCF0718-5G)
Supplier: TCI America
Description: [for Biochemical Research]
CAS Number: 2353-45-9
MDL Number: MFCD00013053
Molecular Formula: C37H36N2O10S3
Molecular Weight: 808.84
Purity/Analysis Method: >85.0% (HPLC,E)
Form: Crystal
Lambda max.: 624 nm (0.02mol/L AcONH4 sol.)

SDS Certificates


Image Unavailable-TCB0790-025G

Erioglaucine disodium salt

Catalog Number: (TCB0790-025G)
Supplier: TCI America
Description: CAS Number: 3844-45-9
MDL Number: MFCD00012141
Molecular Formula: C37H36N2O9S3
Molecular Weight: 792.84
Form: Crystal
Color: Red

SDS Certificates


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
97 - 112 of 43,671
no targeter for Bottom