You Searched For: 2,6-Difluoro-4-hydroxybenzoic+acid


69,386  results were found

SearchResultCount:"69386"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76120-486)
Supplier: Bioss
Description: Ankyrins are membrane adaptor molecules that play important roles in coupling integral membrane proteins to the spectrin-based cytoskeleton network. Mutations of ankyrin genes lead to severe genetic diseases such as fatal cardiac arrhythmias and hereditary spherocytosis. ANKRD26 (ankyrin repeat domain-containing protein 26) is a 1709 amino acid protein that contains five ANK repeats. Expressed at high level in many tissues, including brain, liver, kidney and heart, ANKRD26 may be phosphorylated upon DNA damage by Atm or ATR. ANKRD26 is also expressed in the arcuate and ventromedial nuclei within the hypothalamus and in the ependyma and the circumventricular organs that act as an interface between the peripheral circulation and the brain. It is suggested that alterations in the gene encoding ANKRD26 may lead to obesity. Three isoforms of ANKRD26 exists due to alternative splicing events.


Supplier: Thermo Scientific Chemicals
Description: 2-Hydroxypropyl methacrylate (mixture of isomers) 98% stabilized
Catalog Number: (10096-776)
Supplier: Proteintech
Description: Pyrimidine nucleoside monophosphate kinase [UMP/CMP kinase (UMP/CMPK)] (CMPK1) is also named as CMK, CMPK, UCK, UMK, UMPK and belongs to the adenylate kinase family. It plays a crucial role in the formation of UDP, CDP, and dCDP, which are required for cellular nucleic acid synthesis. CMPK1 can use a broad spectrum of phosphate donors but the best phosphate donors are ATP and dATP. The longest deduced protein contains 228 amino acids and has a calculated molecular mass of 26 kD. However, translation likely begins at the second initiation methionine, resulting in a protein of 196 amino acids. The shorter form is the endogenously translated protein.


Catalog Number: (10092-982)
Supplier: Proteintech
Description: The 26 S proteasome is a 2.5-MDa molecular machine that degrades ubiquitinated proteins in eukaryotic cells. It consists of a proteolytic core particle and two 19 S regulatory particles (RPs) composed of 6 ATPase (RPT) and 13 non-ATPase (RPN) subunits. PSMD6 gene encodes 26S proteasome regulatory subunit RPN7, the characteristic of this protein is not well known to date.


Supplier: MilliporeSigma

SDS

Supplier: Peprotech
Description: IL-22 is a member of the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10Rβ/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant Human IL-22 is a 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains.

Supplier: Thermo Scientific Chemicals
Description: Diethyl (phthalimidomethyl)phosphonate 97%
Catalog Number: (10092-924)
Supplier: Proteintech
Description: Dihydropteridine reductase (QDPR), also named as DHPR and HDHPR, is an essential enzyme in the hydroxylating system of the aromatic amino acids, since it catalyses the regeneration of tetrahydrobiopterin (BH4), the natural cofactor of phenylalanine, tyrosine, and tryptophan hydroxylases, from the quininoid-dihydrobiopterin produced in these coupled reactions. The QDPR protein is active as a dimer, with a subunit Mr of 26 kDa. This protein belongs to the short-chain dehydrogenases/reductases (SDR) family. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C).


Catalog Number: (10072-414)
Supplier: Prosci
Description: IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 is a 33.4 kDa non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains.


Catalog Number: (10072-848)
Supplier: Prosci
Description: IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-β/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant human IL-22 is a 33.6 kDa non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains.


Supplier: Biotium
Description: is a fluorogenic phosphatase substrate that releases the blue fluorescent dye 4-methyl-7-hydroxycoumarin. MUP free acid and its salt are the most widely used fluorogenic substrates for alkaline phosphatase detection.

Supplier: Anaspec Inc
Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Peprotech
Description: IL-19 belongs to the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine, because it up-regulates IL-6 and TNF-α, and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution, IL-19 exists predominantly as a non-disulfide-linked dimer.

Catalog Number: (10118-478)
Supplier: Restek
Description: Contains: Benzoic acid (65-85-0); 4-Chloro-3-methylphenol (59-50-7); 2-Chlorophenol (95-57-8); 2,4-Dichlorophenol (120-83-2); 2,6-Dichlorophenol (87-65-0); 2,4-Dimethylphenol (105-67-9); 4,6-Dinitro-2-methylphenol (Dinitro-o-cresol) (534-52-1); 2,4-Dinitrophenol (51-28-5); Dinoseb (88-85-7); 2-Methylphenol (o-cresol) (95-48-7); 3-Methylphenol (m-cresol) (108-39-4); 4-Methylphenol (p-cresol) (106-44-5); 2-Nitrophenol (88-75-5); 4-Nitrophenol (100-02-7); Pentachlorophenol (87-86-5); Phenol (108-95-2); 2,3,4,6-Tetrachlorophenol (58-90-2); 2,4,5-Trichlorophenol (95-95-4); 2,4,6-Trichlorophenol (88-06-2)

SDS


Catalog Number: (10087-354)
Supplier: Proteintech
Description: GALNS(N-acetylgalactosamine-6-sulfatase) is also named as chondroitinase and belongs to the sulfatase family. It is one of sulfatases required to degrade glycosaminoglycans (GAGs), keratan sulfate (KS) and chondroitin-6-sulfate (C6S) and the enzyme is a dimer derived from two 60 kDa polypeptides, each of which is processed to 40 kDa and 15 kDa polypeptide subunits linked by disulfide bonds. The deduced 522-residue protein is composed of a 26-amino acid N-terminal signal peptide and a mature polypeptide of 496 amino acid residues, including 2 potential asparagine-linked glycosylation sites. Defects in GALNS are the cause of mucopolysaccharidosis type 4A (MPS4A), also known as Morquio A syndrome.


Catalog Number: (CAPI88431)
Supplier: Thermo Scientific
Description: Thermo Scientific Heavy and Light Amino Acids are used to specifically analyze protein expression by mass spectrometry using stable isotope labeling with amino acids in cell culture (SILAC) quantification kits.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
529 - 544 of 69,386
no targeter for Bottom