You Searched For: Disodium+phthalocyanine


69,386  results were found

Sort Results

List View Easy View
SearchResultCount:"69386"
Description: CAS Number: 22307-72-8
MDL Number: MFCD00145388
Molecular Formula: C23H41NO3
Molecular Weight: 379.59
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 92
Catalog Number: TCT1276-025G
Supplier: TCI America

Description: BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with an osteoconductive carrier such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 appears to play an important role in cardiac morphogenesis, and is expressed in a variety of other tissues, including lung, liver, spleen, prostate, ovary, and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains (monomers) linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human/Murine/Rat BMP-2 derived from
Catalog Number: 10779-108
Supplier: Peprotech


Description: POLR3G also named as RNA polymerase III subunit C7 is a 223 amino acid protein, which belongs to eukaryotic RPC7 RNA polymerase subunit family. The molecular weight of POLR3G is 26 kDa. POLR3G localizes in the nucleus and is a component of the RNA polymerase III complex, which may be involved either in the recruitment and stablization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation.
Catalog Number: 10092-580
Supplier: Proteintech


Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 102996-422
Supplier: Anaspec Inc


Description: Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1 beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouse Il1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26% and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in the treatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.
Catalog Number: 75791-604
Supplier: Prosci


Description: Dihydropteridine reductase (QDPR), also named as DHPR and HDHPR, is an essential enzyme in the hydroxylating system of the aromatic amino acids, since it catalyses the regeneration of tetrahydrobiopterin (BH4), the natural cofactor of phenylalanine, tyrosine, and tryptophan hydroxylases, from the quininoid-dihydrobiopterin produced in these coupled reactions. The QDPR protein is active as a dimer, with a subunit Mr of 26 kDa. This protein belongs to the short-chain dehydrogenases/reductases (SDR) family. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C).
Catalog Number: 10092-924
Supplier: Proteintech


Description: Pyrimidine nucleoside monophosphate kinase [UMP/CMP kinase (UMP/CMPK)] (CMPK1) is also named as CMK, CMPK, UCK, UMK, UMPK and belongs to the adenylate kinase family. It plays a crucial role in the formation of UDP, CDP, and dCDP, which are required for cellular nucleic acid synthesis. CMPK1 can use a broad spectrum of phosphate donors but the best phosphate donors are ATP and dATP. The longest deduced protein contains 228 amino acids and has a calculated molecular mass of 26 kD. However, translation likely begins at the second initiation methionine, resulting in a protein of 196 amino acids. The shorter form is the endogenously translated protein.
Catalog Number: 10096-776
Supplier: Proteintech


Description: is a fluorogenic phosphatase substrate that releases the blue fluorescent dye 4-methyl-7-hydroxycoumarin. MUP free acid and its salt are the most widely used fluorogenic substrates for alkaline phosphatase detection.
Catalog Number: 89138-212
Supplier: Biotium


Catalog Number: CA8.14085.0005
Supplier: MilliporeSigma

SDS


Description: IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-β/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant human IL-22 is a 33.6 kDa non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains.
Catalog Number: 10072-848
Supplier: Prosci


Description: Powder. Lot analysis on label.
Catalog Number: CAJT1266-5
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

Description: IL-22 is a member of the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10Rβ/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant Human IL-22 is a 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains.
Catalog Number: 10778-386
Supplier: Peprotech


Description: Contains: Benzoic acid (65-85-0); 4-Chloro-3-methylphenol (59-50-7); 2-Chlorophenol (95-57-8); 2,4-Dichlorophenol (120-83-2); 2,6-Dichlorophenol (87-65-0); 2,4-Dimethylphenol (105-67-9); 4,6-Dinitro-2-methylphenol (Dinitro-o-cresol) (534-52-1); 2,4-Dinitrophenol (51-28-5); Dinoseb (88-85-7); 2-Methylphenol (o-cresol) (95-48-7); 3-Methylphenol (m-cresol) (108-39-4); 4-Methylphenol (p-cresol) (106-44-5); 2-Nitrophenol (88-75-5); 4-Nitrophenol (100-02-7); Pentachlorophenol (87-86-5); Phenol (108-95-2); 2,3,4,6-Tetrachlorophenol (58-90-2); 2,4,5-Trichlorophenol (95-95-4); 2,4,6-Trichlorophenol (88-06-2)
Catalog Number: 10118-478
Supplier: Restek

SDS


Description: IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 is a 33.4 kDa non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains.
Catalog Number: 10072-414
Supplier: Prosci


Description: Thermo Scientific Heavy and Light Amino Acids are used to specifically analyze protein expression by mass spectrometry using stable isotope labeling with amino acids in cell culture (SILAC) quantification kits.
Catalog Number: CAPI88431
Supplier: Thermo Scientific

Description: IL-20 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. IL-20 is a hematopoietic growth factor capable of stimulating colony formation by CD34+ multipotential progenitors, but not by other progenitor cells. IL-20 signals through a receptor system composed of type I IL-20R-α and type II IL-20R-β. Over-expression of IL-20 in keratinocytes expressing both receptor subunits has been implicated in the induction of inflammatory skin disease. Recombinant human IL-20 is a 35.2 kDa homodimeric protein consisting of two 153 amino acid polypeptide chains.
Catalog Number: 10072-846
Supplier: Prosci


945 - 960 of 69,386