Print…

You Searched For: 2,2\'-Dithienyl+disulfide


10,535  results were found

Refine Results Sort by
SearchResultCount:"10535"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10389-176

Anti-PRDX1 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10389-176)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-10389-182

Anti-PRDX1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10389-182)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-10389-174

Anti-PRDX1 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10389-174)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-H-2530.0025BA

(Lys⁸)-Vasopressin

Supplier: Bachem Americas
Description: For desmopressin see H-7675.

Image Unavailable-10778-144

Human Recombinant BMP2 (from E. coli)

Supplier: Peprotech
Description: BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis, and is expressed in a variety of tissues, including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains. Manufactured using all Animal-Free reagents.

Product Image-CA10762-092

Human Recombinant CD54 (Icam-1) (H):Fc (H) (from CHO Cells)

Supplier: Biolegend
Description: ICAM-1, intercellular adhesion molecule 1, is a member of the immunoglobulin superfamily which characterized by heavy glycosylation with an extracellular domain composed of multiple loops created by disulfide bridges within the protein. The dominant structure of this protein is beta sheet which hypothesize the presence of dimerization domains within ICAM-1. Cytokines such as IL-1 and TNFα increases the concentration of ICAM-1 on the cell surface.

Image Unavailable-CAAA12826-14

Titanium (IV) sulfide ≥99.8% (metals basis)

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00049598

Certificates

Product Image-10787-468

Human Recombinant EGF (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Epidermal growth factor (EGF) is a growth factor that stimulates the proliferation, differentiation, and survival of epithelial and epidermal cells. EGF contains three intramolecular disulfide bonds and binds in high affinity to the epidermal growth factor receptor (EGFR). EGF is overexpressed in multiple tumor cell lines and promotes resistance to chemotherapy and radiation treatments.

Image Unavailable-10488-730

Anti-F11 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10488-730)
Supplier: Bioss
Description: This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq, Jul 2008].
Image Unavailable-10488-732

Anti-F11 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10488-732)
Supplier: Bioss
Description: This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq, Jul 2008].
Image Unavailable-10488-734

Anti-F11 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10488-734)
Supplier: Bioss
Description: This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq, Jul 2008].
Image Unavailable-H-2505.0025BA

(Ile⁸)-Oxytocin Trifluoroacetate

Supplier: Bachem Americas
Description: For atosiban see H-6722.

Image Unavailable-103003-366

Human hBD-3

Catalog Number: (103003-366)
Supplier: Anaspec Inc
Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
MW:5155.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10072-060

Human Recombinant Activin A (from E. coli)

Supplier: Prosci
Description: Activin A is a TGF-β family member that exhibits a wide range of biological activities including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in post-menopausal woman have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, Follistatin. Human Activin A is a 26.0 kDa disulfide-linked homodimer of two β A chains, each containing 116 amino acid residues.

Image Unavailable-10389-184

Anti-PRDX1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10389-184)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-H-2255.0001BA

Eel Calcitonin

Catalog Number: (H-2255.0001BA)
Supplier: Bachem Americas
Description: For Elcatonin see H-2214.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
545 - 560 of 10,535
no targeter for Bottom