Print…

You Searched For: (3-Fluorophenyl)acetic+acid


71,120  results were found

Refine Results Sort by
SearchResultCount:"71120"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCB4214-25G

tert-Butyl (3R,5S)-6-hydroxy-3,5-O-isopropylidene-3,5-dihydroxyhexanoate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 124655-09-0
MDL Number: MFCD23098985
Molecular Formula: C13H24O5
Molecular Weight: 260.33
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.06
Specific rotation [a]20/D: -4 deg (C=2, MeOH)
Storage Temperature: 0-10°C

SDS

Image Unavailable-CAAAA10292-AE

Ethyl isovalerate 98%

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00009203 Beilstein Registry No.: 1744677

Certificates

Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-89156-578

Sulindac sulfone ≥94% (by HPLC)

Supplier: Enzo Life Sciences
Description: Induces apoptosis but does not inhibit cyclooxygenase. Inhibits growth and induces apoptosis in human cancer cell lines. Metabolite of Sulindac.

Image Unavailable-CAAAA17385-0I

EDTA tetrasodium salt hydrate 98%

Supplier: Thermo Scientific Chemicals
Description: EDTA tetrasodium salt hydrate 98%

Certificates

Image Unavailable-CAAAA17477-14

Creatine (N-amidinosarcosine), anhydrous 98%

Supplier: Thermo Scientific Chemicals
Description: Creatine (N-amidinosarcosine), anhydrous 98%

Certificates

Image Unavailable-CAAAAA19646-0E

Phenanthrene tech. 90%, Technical Grade

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00001168 Beilstein: 1905428 Soluble in alcohol, benzene, toluene, and glacial acetic acid

Certificates

Image Unavailable-CAAAJ61978-AP

Naphthalene black 10B (naphthol blue black, acid black 1) 0.2% (v/v) in 5% acetic acid

Catalog Number: (CAAAJ61978-AP)
Supplier: Thermo Scientific Chemicals
Description: Liquid

Certificates


Image Unavailable-B-3640.1000BA

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-2-cyclopentylacetic acid

Supplier: Bachem Americas
Description: Sequence: Fmoc-Cpg-OH

Image Unavailable-75811-044

EDTA disodium salt dihydrate, BiotechGrade

Supplier: Spectrum Chemicals
Description: Edetate Disodium, Dihydrate, BiotechGrade is used in molecular biology applications to minimize metal ion contamination and prevent enzymatic activity. EDTA disodium dihydrate is routinely used in electrophoresis DNA and protein separation applications to chelate metal ions required for enzymatic activity that could potentially damage DNA and protein structure.

Image Unavailable-TCD3789-5G

EDTA disodium salt dihydrate ≥99.0% (by titrimetric analysis) for biochemical research

Supplier: TCI America
Description: [for Biochemical Research]
CAS Number: 6381-92-6
MDL Number: MFCD00150037
Molecular Formula: C10H16N2O8
Molecular Weight: 336.21
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 252

SDS Certificates

Image Unavailable-CA8.06862.0500

1-Naphthylacetic acid for synthesis, Sigma-Aldrich®

Catalog Number: (CA8.06862.0500)
Supplier: MilliporeSigma

SDS


Image Unavailable-75811-012

EDTA disodium salt dihydrate ≥99.0% FCC

Supplier: Spectrum Chemicals
Description: Disodium EDTA, Dihydrate, FCC is used as a preservative to inhibit discoloration. Spectrum Chemical manufactured FCC products, including all FCC Disodium products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities

Certificates

Image Unavailable-TCC0473-500G

trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate ≥99.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 125572-95-4
MDL Number: MFCD00149243
Molecular Formula: C14H22N2O8
Molecular Weight: 346.34
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 216

SDS Certificates

Image Unavailable-CAAAAL15368-14

Bzl-Gly-OH ≥98%

Supplier: Thermo Scientific Chemicals
Description: Bzl-Gly-OH ≥98%

Certificates

Image Unavailable-CA8.00077.0250

4'-Methylacetanilide for synthesis, Sigma-Aldrich®

Catalog Number: (CA8.00077.0250)
Supplier: MilliporeSigma
Description: 4'-Methylacetanilide, CAS number:103-89-9, Synonyms:N-p-Tolylacetamide, Acetic acid p-toluidide, 4-Acetamidotoluene, Application:for synthesis

SDS Certificates


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,057 - 1,072 of 71,120
no targeter for Bottom