Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103007-260

TAT - NSF222 Fusion Peptide 1 mg

Description: TAT - NSF222 Fusion Peptide, Sequence: YGRKKRRQRRR - GGG - LDKEFNSIFRRAFASRVFPPE, N-ethyl-maleimide-sensitive factor (NSF) peptide connected to 11 amino acid cell permeable human immunodeficiency virus, Molecular Weight: 4239.9, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-260
Supplier: Anaspec Inc
Image Unavailable-102996-112

Gastrin-1 1 mg

Description: Gastrin-1, rat, Purity: HPLC >/= 95%, Molecular Weight: 2126.3, Sequence: Pyr-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2, Appearance: Powder, Storage: -20 deg C, Size: 1mg
Catalog Number: 102996-112
Supplier: Anaspec Inc
Image Unavailable-103007-656

[Lys(Ac)14]-Histone H3 (9-19) H3K14(Ac) 1 mg

Description: [Lys(Ac)14]-Histone H3 (9-19), H3K14(Ac), Sequence: KSTGG-K(Ac)-APRKQ, Purity: By HPLC greater than or equal to 95%, H3 peptide acetylated at the lysine residue at the 14th position, Molecular Weight: 1199.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-656
Supplier: Anaspec Inc
Image Unavailable-103007-346

Beta - Amyloid (17 - 28) 1 mg

Description: Beta - Amyloid (17 - 28), Human, mouse/rat, Sequence: LVFFAEDVGSNK, This peptide is amino acids 17 to 28 fragment of beta-amyloid, Molecular Weight: 1325.5, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-346
Supplier: Anaspec Inc
Image Unavailable-103006-532

Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin) H3K4(Me2) biotin-labeled 0.25 mg

Description: Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me2), biotin-labeled, Purity: HPLC >/=95%, Sequence (One-Letter Code): ART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin), Molecular weight: 2751.2, Storage: -20 degree C, Size: 0.25 mg
Catalog Number: 103006-532
Supplier: Anaspec Inc
Image Unavailable-103006-280

Influenza NP (147 - 155) (TYQRTRALV) 1 mg

Description: Influenza NP (147 - 155) (TYQRTRALV), Sequence (Three-Letter Code): H - Thr - Tyr - Gln - Arg - Thr - Arg - Ala - Leu - Val - OH, Molecular Weight: 1107.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-280
Supplier: Anaspec Inc
Image Unavailable-103008-484

Histone H2A (1-20)-GGK(Biotin) 1mg

Description: Histone H2A (1-20)-GGK(Biotin), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2556, Sequence: SGRGKQGGKARAKAKTRSSRGG-K(Biotin), Label: Biotin, Histone H2A (1-20) with a C-terminal GG linker, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-484
Supplier: Anaspec Inc
Image Unavailable-103011-400

Calcein, AM 200 uL

Description: Calcein, AM *UltraPure Grade*, 5 mM solution in anhydrous DMSO, CAS no: 148504-34-1, Purity: >/= 95% HPLC, cell-permeant and non-fluorescent compound that is widely used for determining cell viability, Molecular Weight: 994.9, Spectral Properties: Abs/Em = 494/517 nm, Size: 200ul
Catalog Number: 103011-400
Supplier: Anaspec Inc
Image Unavailable-103007-108

Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-108
Supplier: Anaspec Inc
Image Unavailable-102999-618

Cys - beta - Amyloid (1 - 42) 0.1 mg

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 102999-618
Supplier: Anaspec Inc
Image Unavailable-103007-974

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me1) 1 mg

Description: [Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled, Sequence: ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Residues 1 to 21 mono-methylated at Lys-9, Molecular Weight: 2737.2, Size: 1 mg
Catalog Number: 103007-974
Supplier: Anaspec Inc
Image Unavailable-102999-382

Omega - Conotoxin GVIA 1 mg

Description: Omega - Conotoxin GVIA, Sequence: CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY - NH2, Purity: HPLC greater than or equal to 95%, neurotoxin that blocks N-type calcium channels, Molecular Weight: 3037.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-382
Supplier: Anaspec Inc
Image Unavailable-103008-000

[Lys(Me1)27]-Histone H3 (21-44)-GK 0.25 mg

Description: [Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeled, Sequence: ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, Histone H3 amino acid residues 21 to 44 mono-methylated, Molecular Weight: 2931.5, Size: 0.25 mg
Catalog Number: 103008-000
Supplier: Anaspec Inc
Image Unavailable-102996-516

[Arg8]-Vasopressin (AVP)1 mg

Description: [Arg8]-Vasopressin (AVP), Purity: HPLC >/= 95%, Molecular Weight: 1084.3, Sequence: H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2, identified as an important regulator of fluid and electrolyte homeostasis through its anti-diuretic action on the kidney, Size: 1 mg
Catalog Number: 102996-516
Supplier: Anaspec Inc
Image Unavailable-103007-164

HCAM - 2 1 mg

Description: HCAM - 2, Sequence: 6 - FAM - VFDAVTDVIIKNNLKECGLY, A pertussis toxin (PTx) enzyme substrate that is labeled with 6-FAM (6-carboxyfluorescein), Abs/Em=494 nm/521 nm, Molecular Weight: 2613, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-164
Supplier: Anaspec Inc
Image Unavailable-103007-236

Proapoptotic Peptide, (klaklak)2 1 mg

Description: Proapoptotic Peptide, (klaklak)2, Sequence: klaklakklaklak - NH2, Purity: HPLC >/= 95%, Molecular Weight: 1523, Apperance: Lyophilized white powder, Peptide Reconstitution: Proapoptotic peptide is freely soluble in water, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-236
Supplier: Anaspec Inc
129 - 144 of 1,262