Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103010-360

AnaTag* HiLyte* Fluor 647 Protein Labeling Kit

Description: AnaTag* HiLyte* Fluor 647 Protein Labeling Kit *Ultra Convenient* Components: HiLyte Fluor*647 SE 3 vials, Reaction buffer 0.5 Ml, Desalting column 3 Pre-packed columns, DMSO 150 uL, Elution buffer 20 ml, Wash tube/Collect tube: 3 tubes
Catalog Number: 103010-360
Supplier: Anaspec Inc
Image Unavailable-103010-216

DiI [[1,1'-Dioctadecyl-3,3,3',3'- tetramethylindocarbocyanine iodide]] 100 mg

Description: DiI [[1,1'-Dioctadecyl-3,3,3',3'- tetramethylindocarbocyanine iodide]], Molecular Weight: 961.32, A lipophilic membrane stain that diffuses laterally to stain the entire cell, Storage: -20 deg C, size: 100 mg
Catalog Number: 103010-216
Supplier: Anaspec Inc
Image Unavailable-103011-116

OPA 1 g

Description: OPA, Synonym: o - Phthaldialdehyde, UltraPure Grade, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, Molecular Weight: 134.1, Spectral Properties: Abs/Em = 334/456 nm, Solvent System: DMSO or DMF, CAS: 643-79-8, MF: C8H6O2, Size: 1 g
Catalog Number: 103011-116
Supplier: Anaspec Inc
Image Unavailable-103010-816

5(6)-ROX 100 mg

Description: 5(6)-ROX, Synonym: 5-(and-6)-Carboxy-X-rhodamine, dyes have longer excitation and emission wavelength, used to label peptides, proteins, and other biological ligand, MW: 635.8, Spectral Properties: Abs/Em = 568/591 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 100 mg
Catalog Number: 103010-816
Supplier: Anaspec Inc
Image Unavailable-102996-720

Beta-Amyloid Peptide (1-42) 0.5 mg

Description: Beta-Amyloid Peptide (1-42), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4418, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-720
Supplier: Anaspec Inc
Image Unavailable-103010-532

SensoLyte* 520 Cathepsin B Assay Kit

Description: SensoLyte* 520 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 2 mM, 50 ul, HiLyte Fluor* 488 1 mM, 10 ul, Cathepsin B enzyme, human liver 5 ul, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 u
M, 10 ul, DTT 1 M, 100 ul
Catalog Number: 103010-532
Supplier: Anaspec Inc
Image Unavailable-103010-352

AnaTag* HiLyte* Fluor 555 Microscale Protein Labeling Kit

Description: AnaTag* HiLyte* Fluor 555 Microscale Protein Labeling Kit *Ultra Convenient* Component: HiLyte Fluor* 555 SE 3 vials, Reaction buffer 0.5 mL, Spin column, DMSO 150 uL, Elution buffer 20 mL, Wash tube 3 tubes, Collect tube 3 tubes
Catalog Number: 103010-352
Supplier: Anaspec Inc
Image Unavailable-103010-150

SensoLyte* 490 MMP-1 Assay Kit

Description: SensoLyte* 490 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 substrate 270 ul, EDANS 1 mM, 10 ul, APMA, 4-aminophenylmercuric acetate 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C
Catalog Number: 103010-150
Supplier: Anaspec Inc
Image Unavailable-103010-666

SensoLyte* 520 BACE2 Activity Assay

Description: SensoLyte* 520 BACE2 Activity Assay *Fluorimetric*, Components: HiLyte Fluor*488/QXLTM -520 BACE2 substrate 1 mM, 50 uL, HiLyte Fluor*488 1 mM, 15 uL, Assay Buffer 30 mL, BACE2 Inhibitor 50 uM, 15 uL, Stop Solution 10 ml, Optimized Performance, Enhanced Value
Catalog Number: 103010-666
Supplier: Anaspec Inc
Image Unavailable-103003-184

[Glu1]-Fibrinopeptide B 1 mg

Description: [Glu1]-Fibrinopeptide B, Purity: HPLC >/- 95%, Molecular Weight: 1570.6, Sequence: H-Glu-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Lyophilized white powder, This peptide is derived from fibrinopeptide B amino acid residues 1-14, Size: 1 mg
Catalog Number: 103003-184
Supplier: Anaspec Inc
Image Unavailable-103008-236

LCMV GP61 1mg

Description: LCMV GP61, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2276.5, Sequence: GLNGPDIYKGVYQFKSVEFD, An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV), Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-236
Supplier: Anaspec Inc
Image Unavailable-103010-284

Human MMP -8 100 uL

Description: Human MMP - 8, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, Storage: -80 deg C, size: 100 uL
Catalog Number: 103010-284
Supplier: Anaspec Inc
Image Unavailable-103010-290

SensoLyte* Plus 520 MMP-9 Assay Kit

Description: SensoLyte* Plus 520 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 antibody 12 X 8 black strips, MMP-9 STD 10 u
g/mL, 10 ul, MMP dilution buffer 10 mL, 10 X Wash buffer 50 mL, APMA 100 mM, 150 ul, MMP-1 substrate 50 ul, Assay buffer 50 mL, Stop Solution 10 mL
Catalog Number: 103010-290
Supplier: Anaspec Inc
Image Unavailable-103005-942

520 MMP FRET Substrate XIV 0.1 mg

Description: 520 MMP FRET Substrate XIV, Purity: By HPLC >/= 95%, MW: 1913.1, Sequence: (One-Letter Code): QXL* 520 -Y-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Size: 0.1 mg
Catalog Number: 103005-942
Supplier: Anaspec Inc
Image Unavailable-103010-544

SensoLyte* 520 Cathepsin D Assay Kit

Description: SensoLyte* 520 Cathepsin D Assay Kit *Fluorimetric*, Components: Cathepsin D substrate 1 mM, 50 ul, HiLyte Fluor* 488 1 mM, 10 ul, Cathepsin D, bovine spleen 0.1 mg/mL, 10 ul, Assay Buffer 20 mL, Pepstatin A 100 u
M, 20 ul, DTT 1 M, 100 ul, storage: -20 deg C
Catalog Number: 103010-544
Supplier: Anaspec Inc
Image Unavailable-103008-282

Ryanodine receptor 1 (RyR1) (3614-3643) 1mg

Description: Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3616.4, Sequence: KSKKAVWHKLLSKQRRRAVVACFRMTPLYN, amino acids 3614-3643 fragment, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-282
Supplier: Anaspec Inc
113 - 128 of 1,262