Mouse;Rat Beta-Amyloid (1-42)

Supplier: Anaspec Inc

AS-25381 AS-25231
102996-720EA 903.08 CAD
102996-720 103003-804
Mouse;Rat Beta-Amyloid (1-42)
Proteins and Peptides

This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Citations:
Wyss-Coray, T. et al. (2003). Adult mouse astrocytes degrade amyloid-bold beta in vitro and in situ. Nature Med 9, 453. doi: 10.1038/nm838.

Sawamura, N. et al. (2000). Mutant Presenilin 2 transgenic mice. J. Biol. Chem. 275, 27901. doi: 10.1074/jbc.M004308200.


Sawamura, N. et al. (2000). Mutant Presenilin 2 transgenic mice. J. Biol. Chem. 275, 27901. doi: 10.1074/jbc.M004308200.


Citations:
Wyss-Coray, T. et al. (2003). Adult mouse astrocytes degrade amyloid-bold beta in vitro and in situ. Nature Med 9, 453. doi: 10.1038/nm838.

Sawamura, N. et al. (2000). Mutant Presenilin 2 transgenic mice. J. Biol. Chem. 275, 27901. doi: 10.1074/jbc.M004308200.

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR