You Searched For: Anaspec Inc

Description: Chlorotoxin (Cltx), Purity: >/= 95%, MW: 3996, Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus, Appearance: Lyophilized white powder, Size: 0.1 mg

Catalog Number: 103005-970

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-42), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4418, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-720

Supplier: Anaspec Inc

Sale

Description: 5(6)-ROX, Synonym: 5-(and-6)-Carboxy-X-rhodamine, dyes have longer excitation and emission wavelength, used to label peptides, proteins, and other biological ligand, MW: 635.8, Spectral Properties: Abs/Em = 568/591 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 100 mg

Catalog Number: 103010-816

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 555 Microscale Protein Labeling Kit *Ultra Convenient* Component: HiLyte Fluor* 555 SE 3 vials, Reaction buffer 0.5 mL, Spin column, DMSO 150 uL, Elution buffer 20 mL, Wash tube 3 tubes, Collect tube 3 tubes

Catalog Number: 103010-352

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 substrate 270 ul, EDANS 1 mM, 10 ul, APMA, 4-aminophenylmercuric acetate 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-150

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 2 mM, 50 ul, HiLyte Fluor* 488 1 mM, 10 ul, Cathepsin B enzyme, human liver 5 ul, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 u
M, 10 ul, DTT 1 M, 100 ul

Catalog Number: 103010-532

Supplier: Anaspec Inc

Sale

Description: OPA, Synonym: o - Phthaldialdehyde, UltraPure Grade, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, Molecular Weight: 134.1, Spectral Properties: Abs/Em = 334/456 nm, Solvent System: DMSO or DMF, CAS: 643-79-8, MF: C8H6O2, Size: 1 g

Catalog Number: 103011-116

Supplier: Anaspec Inc

Sale

Description: Cathepsin K substrate, Sequence: Abz - HPGGPQ - EDDnp, Purity: By HPLC greater than or equal to 95%, FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids, Molecular Weight: 920, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-314

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)20]-Histone H4 (8-30)- WGK(Biotin); H4K20(Me2) (8-30), Purity: HPLC >/= 95%, MW: 3170.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)], amino acid residues 8-30 with a C-terminal WG linker, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-612

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g

Catalog Number: 103011-046

Supplier: Anaspec Inc

Sale

Description: TAT (47-57) GGG-Cys(Npys) protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), Purity: HPLC>/=95%, Sequence (One-Letter Code): YGRKKRRQRRRGGG-C(Npys)-NH2, Molecular weight: 1987.3, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-428

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-3, PAR-3 Agonist, amide, Sequence: SFNGGP-NH2, Purity: By HPLC >/= 95%, peptide is one of the four PAR sub-types, and is acted upon by thrombin, Molecular Weight: 576.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-560

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRN-NH2, Purity: By HPLC >/= 95%, proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptor, Molecular Weight: 761.9, Size: 5 mg

Catalog Number: 103007-558

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Plus 520 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 antibody 12 X 8 black strips, MMP-9 STD 10 u
g/mL, 10 ul, MMP dilution buffer 10 mL, 10 X Wash buffer 50 mL, APMA 100 mM, 150 ul, MMP-1 substrate 50 ul, Assay buffer 50 mL, Stop Solution 10 mL

Catalog Number: 103010-290

Supplier: Anaspec Inc

Sale

Description: Human MMP - 8, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, Storage: -80 deg C, size: 100 uL

Catalog Number: 103010-284

Supplier: Anaspec Inc

Sale

Description: Peptide Substrate for Renin 520 Assay kit, Purity: HPLC greater than or equal to 95%, Molecular Weight: 2000 - 2200, Appearance: Lyophilized red powder, for screening of renin inhibitors, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103007-076

Supplier: Anaspec Inc

Sale