You Searched For: Anaspec Inc

Description: CEF Control Peptide Pool, contains 0.25 mg (net) of the 32 CEF peptides, Used in the stimulation of IFNY release from CD8+ T cells in individuals, ELISPOT, intracellular cytokine and CTL assays, Storage: -20 degree C, Size: 8 mg

Catalog Number: 103006-276

Supplier: Anaspec Inc

Sale

Description: Penetratin-Arg, Purity: HPLC >/= 95%, MW: 2358.8, Sequence: RQIRIWFQNRRMRWRR] Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-970

Supplier: Anaspec Inc

Sale

Description: Chlorotoxin (Cltx), Purity: >/= 95%, MW: 3996, Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus, Appearance: Lyophilized white powder, Size: 0.1 mg

Catalog Number: 103005-970

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)16]-Histone H4 (1-20), H4K16(Ac), Sequence: SGRGKGGKGLGKGGA-K(Ac)-RHRK, Purity: By HPLC greater than or equal to 95%, Histone 4 peptide is acetylated at lysine 16, Molecular Weight: 2034.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-668

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (11-40), FAM-labeled, Human, Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 3510, Apperance: powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-566

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)20]-Histone H4 (8-30)- WGK(Biotin); H4K20(Me2) (8-30), Purity: HPLC >/= 95%, MW: 3170.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)], amino acid residues 8-30 with a C-terminal WG linker, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-612

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-3, PAR-3 Agonist, amide, Sequence: SFNGGP-NH2, Purity: By HPLC >/= 95%, peptide is one of the four PAR sub-types, and is acted upon by thrombin, Molecular Weight: 576.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-560

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g

Catalog Number: 103011-046

Supplier: Anaspec Inc

Sale

Description: TAT (47-57) GGG-Cys(Npys) protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), Purity: HPLC>/=95%, Sequence (One-Letter Code): YGRKKRRQRRRGGG-C(Npys)-NH2, Molecular weight: 1987.3, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-428

Supplier: Anaspec Inc

Sale

Description: Cathepsin K substrate, Sequence: Abz - HPGGPQ - EDDnp, Purity: By HPLC greater than or equal to 95%, FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids, Molecular Weight: 920, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-314

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRN-NH2, Purity: By HPLC >/= 95%, proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptor, Molecular Weight: 761.9, Size: 5 mg

Catalog Number: 103007-558

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (3 - 40), Human, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Molecular Weight: 4143.7, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103006-264

Supplier: Anaspec Inc

Sale

Description: BrdU, Synonym: 5 - Bromo - 2’ - deoxyuridine, Biomarker for cell cycle and cell proliferation, MW: 307.1, Spectral Properties: Abs/Em = ND/none nm, Solvent System: DMSO, Form: Solid, MF: C9H11BrN2O5, CAS No: 59-14-3, Storage -20 deg C desiccated and protected from light, Size: 25 mg

Catalog Number: 103011-146

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-164

Supplier: Anaspec Inc

Sale

Description: Bid BH3, FAM labeled, pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis, Purity: HPLC >/=95%, Sequence(1-Letter Code): 5-FAM-EDIIRNIARHLAQVGDSMDR, MW: 2667.9, Storage: -20C, Size: 1mg

Catalog Number: 103006-924

Supplier: Anaspec Inc

Sale

Description: Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate, Purity: By HPLC >/= 95%, MW: 1145.2, Sequence: (One-Letter Code): Mca-YVADAPK(Dnp), Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-964

Supplier: Anaspec Inc

Sale