You Searched For: Anaspec Inc

Description: HiLyte* Fluor 488 hydrazide, carbonyl-reactive fluorescent labeling dye, for labeling glycoproteins as HRP, Molecular Weight: 388.38, Spectral Properties: Abs/Em = 503/528 nm, Solvent System: DMF or DMSO, Size: -20 deg C, Store away from oxidizing agent, Size: 1 mg

Catalog Number: 103010-880

Supplier: Anaspec Inc

Sale

Description: SensoLyte* FDP Alkaline Phosphatase Assay Kit *Fluorimetric*, Components: FDP, 1 vial, 2X Assay buffer 30 mL, Stop solution 30 mL, 10X Lysis buffer 50 mL, Triton X-100 500 ul, 500 ul, Alkaline Phosphatase Standard Calf Intestine 10 u
g/mL, 50 ul

Catalog Number: 103010-122

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-2, PAR-2 Agonist, amide MW: 778, Sequence: 2-Furoyl-LIGRLO-NH2] The peptide 2-furoyl-LIGRLO-NH2 showed higher potency and receptor selectivity, Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103010-024

Supplier: Anaspec Inc

Sale

Description: EA (52-68), class II MHC EA chain (EA) (52-68) peptide (AbBEp). It occupies about 10% of natural Iab, Purity: HPLC >/=95%, Sequence (One-Letter Code): ASFEAQGALANIAVDKA, Molecular weight: 1675.9, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-882

Supplier: Anaspec Inc

Sale

Description: Bacterial Sortase Substrate I, FRET, Sequence: DABCYL - LPETG - EDANS, Purity: By HPLC greater than or equal to 95%, sortase substrate, C-terminal sorting signal, Molecular Weight: 1015.2, Apperance: Lyophilized red powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-254

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Thrombin Activity Assay Kit *Fluorimetric*, Components: Thrombin substrate 2 mM, 50 ul, 5-FAM 2 mM, 10 ul, 2X Assay buffer 20 mL, Purified human thrombin enzyme 0.1 mg/mL, 40 ul,Thrombin inhibitor 60 u
M, 10 ul, Stop solution 5 mL

Catalog Number: 103010-466

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)27]-Histone H3 (23-34), H3K27(Me2), Sequence: KAAR-K(Me2)-SAPATGG, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27, Molecular Weight: 1142.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-032

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 250 mg

Catalog Number: 103010-746

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)382]-p53 (372-389), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2473, Sequence: Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG, Label: Biotin, derived from amino acid residues 372-389 of p53 tumor suppressor protein, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-518

Supplier: Anaspec Inc

Sale

Description: Histone H4 (8-30)-WGK(Biotin), Purity: HPLC >/= 95%, MW: 3142.7, Sequence: [Ac-KGLGKGGAKRHRKVLRDNIQGIT-WGK(biotin)] This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-604

Supplier: Anaspec Inc

Sale

Description: AnaTag* 5 - FITC Microscale Protein Labeling Kit *Ultra Convenient* Components: 5-FITC 3 vials, Reaction buffer 0.5 Ml, Spin column 3 Pre-packed columns, DMSO 150 uL, Elution buffer 20 ml, Wash tube/Collect tube: 3 tubes, storage: 4 deg C

Catalog Number: 103010-376

Supplier: Anaspec Inc

Sale

Description: Histone H2B (21-41), biotin-labeled, Sequence: AQKKDGKKRKRSRKESYSIYVGG-K(Biotin), Purity: By HPLC >/= 95%, Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine, Molecular Weight: 3024.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-048

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ADHP Peroxidase Assay Kit, Components: ADHP 10 mM, 250 ul, H2O2 1 vial, Assay buffer 60 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-128

Supplier: Anaspec Inc

Sale

Description: RYR2 (2460-2495), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4103.9, Sequence: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP, amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2), controls calcium release, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-442

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1 - 20), PRMT7 Substrate, M1, Sequence: SGRGKGGKGLGKGGAKRHRK - NH2, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1991.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-370

Supplier: Anaspec Inc

Sale

Description: EndoFree Recombinant Human alpha-Synuclein Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, Thioflavin T assay, Application: Fibrillation, oligomerization, cell toxicity studies, Storage: 2-4 degree C, Size: 500ug

Catalog Number: 103001-646

Supplier: Anaspec Inc

Sale