You Searched For: Anaspec Inc

Description: Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain, Sequence: HDAPIGYD, Purity: HPLC >/= 95%, e-PKC specific activator, it also activates MARCKS phosphorylation, Molecular Weight: 886.9, Size: 1 mg

Catalog Number: 103007-230

Supplier: Anaspec Inc

Sale

Description: HIV Protease FRET Substrate I, Purity: HPLC >/= 95%, Molecular Weight: 1532.5, Sequence: DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS, Appearance: Lyophilized red powder, It is widely used for the continuous assay for HIV protease activity, Size: 1 mg

Catalog Number: 102996-366

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 HCV Protease Assay Kit *Fluorimetric*, Components: HCV NS3/4A protease substrate 600 ul, EDANS 100 u
M DMSO solution, 20 ul, 2X Assay buffer 50 mL, Stop solution 30 mL, DTT 1 M, 1 mL X 2 vials, Pep4AK, HCV NS3 protease cofactor 300 ul, 600 u
M

Catalog Number: 103010-146

Supplier: Anaspec Inc

Sale

Description: Transdermal Peptide, Sequence: ACSSSPSKHCG, short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin and enable macromolecular drugs to reach systemic circulation, Molecular Weight: 1063.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-172

Supplier: Anaspec Inc

Sale

Description: Prodan, Synonym: 6 - Propionyl - 2 - dimethylaminonaphthalene, Environment-sensitive dye for studying membranes and structures of proteins, MW: 227.3, Spectral Properties: Abs/Em = 363/497 nm, Solvent System: DMF, Molecular Formula: C15H17NO, CAS No: 70504-01-7, Size: 25 mg

Catalog Number: 103011-376

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g

Catalog Number: 103011-046

Supplier: Anaspec Inc

Sale

Description: Bid BH3, FAM labeled, pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis, Purity: HPLC >/=95%, Sequence(1-Letter Code): 5-FAM-EDIIRNIARHLAQVGDSMDR, MW: 2667.9, Storage: -20C, Size: 1mg

Catalog Number: 103006-924

Supplier: Anaspec Inc

Sale

Description: Chlorotoxin (Cltx), Purity: >/= 95%, MW: 3996, Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus, Appearance: Lyophilized white powder, Size: 0.1 mg

Catalog Number: 103005-970

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 HIV Protease Assay Kit *Fluorimetric*, Components: HIV-1 protease substrate 600 ul, EDANS 100 u
M DMSO solution, 20 ul, Pepstatin A 27.4 u
g powder, 2X Assay buffer 50 mL, Stop solution 30mL, DMSO 100 ul, DMSO 100 ul, storage: -20 deg C

Catalog Number: 103010-148

Supplier: Anaspec Inc

Sale

Description: Integrin-Binding Site

Catalog Number: 103007-154

Supplier: Anaspec Inc

Sale

Description: Human MMP - 8, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, Storage: -80 deg C, size: 100 uL

Catalog Number: 103010-284

Supplier: Anaspec Inc

Sale

Description: Mouse;Rat Beta-Amyloid (1-42)

Catalog Number: 102996-720

Supplier: Anaspec Inc

Sale

Description: Human ACE Substrate 2

Catalog Number: 103005-964

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 substrate 270 ul, EDANS 1 mM, 10 ul, APMA, 4-aminophenylmercuric acetate 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-150

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (11-40), FAM (Carboxyfluorescein)

Catalog Number: 103007-566

Supplier: Anaspec Inc

Sale

Description: [Glu1]-Fibrinopeptide B

Catalog Number: 103003-184

Supplier: Anaspec Inc

Sale