Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103008-322

[Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin) H3K18(Me2) 1mg

Description: [Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2750.2, Sequence: ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-322
Supplier: Anaspec Inc
Image Unavailable-103006-980

Erktide 1 mg

Description: Erktide, peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli, Purity: HPLC >/= 95%, Sequence (One-Letter Code): IPTTPITTTYFFFK, MW: 1677, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-980
Supplier: Anaspec Inc
Image Unavailable-103007-790

P70 S6 Kinase Substrate 1 mg

Description: P70 S6 Kinase Substrate, Sequence: KKRNRTLTV, Purity: By HPLC greater than or equal to 95%, This peptide is a substrate for p70 ribosomal S6 kinase, Molecular Weight: 1115.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-790
Supplier: Anaspec Inc
Image Unavailable-103006-672

LL-37 scrambled 1 mg

Description: LL-37, scrambled, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, Molecular Weight: 4493.3, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-672
Supplier: Anaspec Inc
Image Unavailable-103009-512

[Ser(OGlcNAc)]400-KWK-Tau (388-411)-KK-NH2

Description: [Ser(OGlcNAc)]400-KWK-Tau (388-411)-KK(Biotin)-NH2, Purity: HPLC >/= 95%, MW: 3677.3, Sequence: [KWKHGAEIVYKSPVV-S(OGlcNAc)-GDTSPRHLSNVK-K(biotin)-NH2], Store: -20 deg C, Size: 1mg
Catalog Number: 103009-512
Supplier: Anaspec Inc
Image Unavailable-103005-328

RGD - 4C 5 mg

Description: RGD - 4C, Purity: >/= 95%, MW: 1145.3, Sequence: ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis, Appearance: Lyophilized white powder, freely soluble in H2O, Size: 5 mg
Catalog Number: 103005-328
Supplier: Anaspec Inc
Image Unavailable-103006-990

Beta-Amyloid (1-15) Human 1 mg

Description: Beta-Amyloid (1-15), Human, Purity: HPLC >/= 95%, Sequence (1-Letter Code): DAEFRHDSGYEVHHQ, Sequence (3-Letter Code): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH, Molecular weight: 1826.9, Physical State: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-990
Supplier: Anaspec Inc
Image Unavailable-103006-110

MBP (90-106) 1 mg

Description: MBP (90-106) HLA-A*0201-restricted peptide derived from melanoma antigens encoded by MAGE-3, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): Ac-FFKNIVTPRTPPPSQGK-NH2, Molecular Weight: 1058.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-110
Supplier: Anaspec Inc
Image Unavailable-103007-120

Beta - Amyloid (25 - 35) 1 mg

Description: Beta - Amyloid (25 - 35), scrambled, Human, mouse/rat, Sequence: MAKGINGISGL, Purity: By HPLC greater than or equal to 95%, used to recognize its structure and functions, Molecular Weight: 1060.3, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-120
Supplier: Anaspec Inc
Image Unavailable-103007-616

5-FAM-PMDM6 (PMDM6-F) 1 mg

Description: 5-FAM-PMDM6 (PMDM6-F), Sequence: 5-FAM-(B-A)-(B-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2, Purity: By HPLC greater than or equal to 95%, PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay, Molecular Weight: 1784.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-616
Supplier: Anaspec Inc
Image Unavailable-103002-738

SAMS Peptide 5mg

Description: SAMS Peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1778.2, Sequence: (one-Letter Code) HMRSAMSGLHLVKRR - NH2, synthetic peptide substrate specific for AMP-activated protein kinase (AMPK), Storage: At -20 Degree C, Size: 5mg
Catalog Number: 103002-738
Supplier: Anaspec Inc
Image Unavailable-103007-180

Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31) 1 mg

Description: Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31), Sequence: AAVTPEERHLSKMQQNGYENPTYKFFEQMQN, C31 peptide is a potent inducer of apoptosis, Molecular Weight: 3717.1, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-180
Supplier: Anaspec Inc
Image Unavailable-103006-426

Cys(Npys)-TAT (47-57) 1 mg

Description: Cys(Npys)-TAT (47-57), cell penetrating and carrier peptide applicable in conjugation studies, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): C(Npys)YGRKKRRQRRR-NH2, MW: 1816.1, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-426
Supplier: Anaspec Inc
Image Unavailable-103011-414

HiLyte* Fluor 532 hydrazide 1 mg

Description: HiLyte* Fluor 532 hydrazide, carbonyl-reactive fluorescent labeling dye, with fluorescence excitation and emission maxima of Approx 545 nm and Approx 565 nm, Molecular Weight: 792.37, Spectral Properties: Abs/Em = 545/565 nm, Solvent System: Water or DMF, Size: 1 mg
Catalog Number: 103011-414
Supplier: Anaspec Inc
Image Unavailable-103008-536

[Lys(Ac)16]-Histone H4 (1-21)-GGK(Biotin) H4K16(Ac) 1mg

Description: [Lys(Ac)16]-Histone H4 (1-21)-GGK(Biotin), H4K16(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2644.1, Sequence: Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-536
Supplier: Anaspec Inc
Image Unavailable-103010-420

SensoLyte* 520 Cathepsin S Assay Kit

Description: SensoLyte* 520 Cathepsin S Assay Kit *Fluorimetric*, Components: 5-FAM/QXL* 520, Cathepsin S substrate 1.6 mM, 50 ul, 5-FAM 1 mM, 10 ul, Cathepsin S, human spleen 0.1 mg/mL, 10 ul, Assay Buffer 20 mL, Cathepsin S Inhibitor 1 mM, 10 ul, DTT 1 M, 100 ul
Catalog Number: 103010-420
Supplier: Anaspec Inc
193 - 208 of 1,262