You Searched For: Anaspec Inc

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 100ug

Catalog Number: 102998-096

Supplier: Anaspec Inc

Sale

Description: Caerulein, Purity: HPLC >/- 95%, Molecular Weight: 1352.4, Sequence: Pyr-Gln-Asp-Tyr(SO3H)-Thr-Gly-Trp-Met-Asp-Phe-NH2, is a decapeptide analog of the potent pancreatic secretagogue cholecystokinin, stimulates gastric, biliary/ pancreatic secretion, Size: 1 mg

Catalog Number: 103003-710

Supplier: Anaspec Inc

Sale

Description: HATPPKKKRK, Purity: HPLC >/- 95%, Molecular Weight: 1190.5, Sequence: H-His-Ala-Thr-Pro-Pro-Lys-Lys-Lys-Arg-Lys-OH, The native peptide, is a substrate for cyclin-dependent protein kinase 1, used to develop assays for CDK1, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-204

Supplier: Anaspec Inc

Sale

Description: Calcein, AM, CAS number: 148504-34-1, Purity: >/= 95% by HPLC, cell-permeant and non-fluorescent compound that is widely used for determining cell viability, MW: 994.9, Spectral Abs/Em = 494/517 nm, Solvent System: DMSO, Appearance: White solid, Assay: HPLC > 95%, Size: 1 mg

Catalog Number: 103011-396

Supplier: Anaspec Inc

Sale

Description: HCV Protease FRET Substrate (RET S1), Purity: HPLC >/= to 95%, Molecular Weight: 1548.6, Sequence: Ac-DE-D(Edans)-EE-Abu-psi-[COO]-AS-K(Dabcyl)-NH2, Appearance: Lyophilized white powder, is a HCV protease substrate, Storage: -20 deg C, Size: 0.25 mg

Catalog Number: 102996-360

Supplier: Anaspec Inc

Sale

Description: 5-FTSC, Synonym: Fluorescein-5-thiosemicarbazide, reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones, Molecular Weight: 421.4, Spectral Properties: Abs/Em = 492/516 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 25 mg

Catalog Number: 103011-026

Supplier: Anaspec Inc

Sale

Description: HCV Protease FRET Substrate (RET S1), Purity: HPLC >/= to 95%, Molecular Weight: 1548.6, Sequence: Ac-DE-D(Edans)-EE-Abu-psi-[COO]-AS-K(Dabcyl)-NH2, Appearance: Lyophilized white powder, is a HCV protease substrate, Storage: -20 deg C, Size: 100 mg

Catalog Number: 102996-362

Supplier: Anaspec Inc

Sale

Description: [Pyr1] - Apelin - 13, Purity: By HPLC >/= 95%, MW: 1533.8, Sequence: (One-Letter Code): Pyr-RPRLSHKGPMPF-OH [125I]-(Pyr1)Apelin-13 binds with high affinity and selectivity to human cardiac tissue, Appearance: Lyophilized white powder, Size: 1 mg

Catalog Number: 103005-982

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 FRET SIRT1 Assay Kit *Fluorimetric*, Components: SIRT1 520 FRET substrate 1 mM, 50 ul, Deacetylated FRET 1 mM, 20 ul, SIRT1, Human Recom 0.1 mg/mL, 100 ul, Assay Buffer 20 mL, NAD+ 20 mM, 100 ul, Nicotinamide 30 m?, 0.5 mL, SIRT1 Developer 0.5 mL

Catalog Number: 103010-514

Supplier: Anaspec Inc

Sale

Description: Erythropoietin-Mimetic Peptide 17 (EMP17), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1981.3, Sequence: TYSCHFGPLTWVCKPQGG, EMP17 is the hormone involved in red blood cell production, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-150

Supplier: Anaspec Inc

Sale

Description: Indo-1, AM, Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1009.9, Spectral Properties: Abs/Em = 346/475 nm, Solvent System: DMSO, Molecular Formula: C47H51N3O22C47H51N3O22, CAS number: 112926-02-0, Size: 1 mg

Catalog Number: 103011-166

Supplier: Anaspec Inc

Sale

Description: CFP10 (71-85), 15-mer peptide is fragment of (CFP)10 protein, which is secreted from mycobacterium tuberculosis 10-kDa culture filtrate stimulate, Purity: HPLC >/= 95%, Sequence (One-Letter Code): EISTNIRQAGVQYSR, Molecular weight: 1721.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-902

Supplier: Anaspec Inc

Sale

Description: Tat-Beclin-1, scrambled, Purity: HPLC >/= 95%, MW: 3741.1, Sequence: YGRKKRRQRRRGGVGNDFFINHETTGFATEW] Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-978

Supplier: Anaspec Inc

Sale

Description: S6 Kinase Substrate (229 - 239), Purity: HPLC >/= 95%, Molecular Weight: 1313.6, Sequence: H-Ala-Lys-Arg-Arg-Arg-Leu-Ser-Ser-Leu-Arg-Ala-OH, Appearance: Lyophilized white powder, This is a synthetic peptide substrate for S6 kinase, Size: 1 mg

Catalog Number: 102996-884

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 270 ul, EDANS 1 mM DMSO solution, 10ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed

Catalog Number: 103010-160

Supplier: Anaspec Inc

Sale

Description: OVA (329-337), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 925, Sequence: AAHAEINEA; (Three-Letter Code) H - Ala - Ala - His - Ala - Glu - Ile - Asn - Glu - Ala - OH, sequence is OVA (ovalbumin) peptide residues 257 to 280, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-446

Supplier: Anaspec Inc

Sale