Print…

You Searched For: trans-4-Fluoro-L-proline


4,476  results were found

Refine Results Sort by
SearchResultCount:"4476"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCE1251-5G

trans,trans-4'-Ethylbicyclohexyl-4-carboxylic acid ≥98.0% (by GC, titration analysis)

Catalog Number: (TCE1251-5G)
Supplier: TCI America
Description: Trans,Trans-4'-Ethylbicyclohexyl-4-Carboxylic Acid, Purity: >98.0%(GC)(T), Cas no: 84976-67-0, Molecular formula : C15H26O2, Molecular weight : 238.37, Synonyms: trans-4-(trans-4-Ethylcyclohexyl)cyclohexanecarboxylic Acid, Size: 5G
Image Unavailable-10794-134

Anti-DMRTB1 Rabbit Polyclonal Antibody

Catalog Number: (10794-134)
Supplier: Genetex
Description: Rabbit polyclonal antibody to DMRTB1
Image Unavailable-TCF1102-5G

trans,trans-4-(4-Fluorophenyl)-4'-propylbicyclohexyl ≥98.0% (by GC)

Supplier: TCI America
Description: trans,trans-4-(4-Fluorophenyl)-4'-propylbicyclohexyl, Purity: >98.0%(GC), CAS number: 82832-27-7, Molecular Formula: C21H31F, Molecular Weight: 302.48, Size: 1G

Image Unavailable-76107-570

Anti-PROCA1 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76107-570)
Supplier: Bioss
Description: Belongs to the PROCA1 family.
Product Image-89416-602

Anti-DLGAP2 Rabbit Polyclonal Antibody

Catalog Number: (89416-602)
Supplier: Prosci
Description: SAPAP2 Antibody: SAP90/PSD-95-associated protein 2 (SAPAP2, also known as DLGAP2) is a member of a protein family whose members specifically interact with PSD-95/SAP90, a membrane-associated guanylate kinase localized at postsynaptic density (PSD) in neuronal cells. Like the other SAPAP proteins, SAPAP2 is thought to be an adaptor protein that also interacts with different synaptic scaffolding proteins, cytoskeletal and signaling components, such as focal adhesion kinase (FAK) and proline-rich tyrosine kinase 2 (PYK2). SAPAP2 mRNA is targeted to cell bodies in a similar manner to SAPAP1 and -4, whereas SAPAP3 mRNA is detected mainly in cell bodies.
Image Unavailable-102998-454

salmon Calcitonin, salmon

Catalog Number: (102998-454)
Supplier: Anaspec Inc
Description: A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-10366-330

Anti-LCK Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10366-330)
Supplier: Bioss
Description: This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described. [provided by RefSeq, Jul 2008].
Image Unavailable-10388-934

Anti-LPP Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10388-934)
Supplier: Bioss
Description: LPP (LIM containing lipoma preferred partner), is a scaffolding protein which contains three LIM domains at its carboxy terminus, preceded by a proline rich pre LIM region containing a number of protein interaction domains. LPP localizes to sites of cell adhesion, such as focal adhesions and cell-cell contacts and may be involved in cell-cell adhesion and cell motility. LPP also shuttles through the nucleus and may function as a transcriptional co-activator. The human LPP gene maps to chromosomal location 3q28, and preferentially translocates to the HMGIC gene in a subclass of human benign mesenchymal tumors known as lipomas. Alternate splicing results in multiple transcript variants.
Image Unavailable-CAPIPA5-17976

Anti-FGR Goat Polyclonal Antibody

Catalog Number: (CAPIPA5-17976)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with canine, human and rat based on sequence homology. This gene is a member of the Src family of protein tyrosine kinases . The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Image-10091-982

Anti-PDCD6IP Rabbit Polyclonal Antibody

Catalog Number: (10091-982)
Supplier: Proteintech
Description: ALG-2-interacting protein 1 (ALIX), also known as AIP1 or Hp95, is encoded by PDCD6IP gene and is involved in cell death through mechanisms involving its binding partner ALG-2 (apoptosis-linked gene-2). ALG-2 is a 22-kDa protein containing five serially repetitive EF-hand structures and is defined as a regulator of calcium-induced apoptosis following endoplasmic reticulum (ER) stress. ALIX interacts with ALG-2 through its C-terminal proline-rich region and participates in formation of multivesicular bodies. Recent finding suggest that ALIX is a critical component of caspase 9 activation and apoptosis triggered by calcium.
Product Image-89417-172

Anti-RUSC2 Rabbit Polyclonal Antibody

Catalog Number: (89417-172)
Supplier: Prosci
Description: RUSC2 Antibody: RUSC2, also known as Iporin, shares with the related protein RUSC1 a common domain structure of RUN, leucine zipper and SH3 domain in addition to over 30% amino acid identity. RUSC2 is a rab1-interacting protein that also interacts with GM130, another rab1-interacting protein. RUSC2 interacts with specific rab1 isoforms with different rab-binding specificity. It has been suggested that RUSC2 may function as a link between the targeting of ER derived vesicles triggered by the rab1 GTPase and a signaling pathway composed of proteins containing SH3 and/or poly-proline regions.
Image Unavailable-10794-658

Anti-Dmrtb1 Rabbit Polyclonal Antibody

Catalog Number: (10794-658)
Supplier: Genetex
Description: Rabbit polyclonal antibody to DMRTB1
Product Image-10070-614

Anti-LPP Mouse Monoclonal Antibody [clone: 8B3A11]

Catalog Number: (10070-614)
Supplier: Prosci
Description: LIM containing lipoma preferred partner, it belongs to the zyxin family. The Zyxin family of proteins contains five members, Ajuba, LIMD1, LPP, TRIP6 and Zyxin. LPP, an 80 kDa protein and a LIM domain-containing scaffolding protein contains three LIM domains at its carboxy terminus, which are preceded by a proline-rich pre-LIM region containing a number of protein interaction domains. The LPP localizes to sites of cell adhesion, such as focal adhesions and cell-cell contacts, and shuttles to the nucleus where it has transcriptional activation capacity.
Image Unavailable-TCP2317-5G

trans,trans-4-Propyl-4'-vinylbicyclohexyl ≥98.0% (by GC)

Supplier: TCI America
Description: Trans,trans-4-Propyl-4'-vinylbicyclohexyl, Purity: >98.0%(GC), Cas number: 116020-44-1, Molecular Formula: C17H30, Molecular Weight: 234.43, Appearance: White - Almost white solid crystal lump, Size: 25G

SDS

Image Unavailable-10375-622

Anti-VASP Rabbit Polyclonal Antibody

Catalog Number: (10375-622)
Supplier: Bioss
Description: Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG. [provided by RefSeq].
Product Image-89416-610

Anti-DLGAP4 Rabbit Polyclonal Antibody

Catalog Number: (89416-610)
Supplier: Prosci
Description: SAPAP4 Antibody: SAP90/PSD-95-associated protein 4 (SAPAP4, also known as DLGAP4) is a member of a protein family whose members specifically interact with PSD-95/SAP90, a membrane-associated guanylate kinase localized at postsynaptic density (PSD) in neuronal cells. Like the other SAPAP proteins, SAPAP4 is thought to be an adaptor protein that also interacts with different synaptic scaffolding proteins, cytoskeletal and signaling components, such as focal adhesion kinase (FAK) and proline-rich tyrosine kinase 2 (PYK2). SAPAP4 mRNA is targeted to cell bodies in a similar manner to SAPAP1 and -2, whereas SAPAP3 mRNA is detected mainly in cell bodies.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
657 - 672 of 4,476
no targeter for Bottom