You Searched For: chromatography+caps


31,754  results were found

SearchResultCount:"31754"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (89221-120)
Supplier: Hamilton
Description: Hamilton Company offers one of the most comprehensive selections of chromatography columns in the industry.


Supplier: Hamilton
Description: Hamilton Company offers one of the most comprehensive selections of chromatography equipment in the industry.

Supplier: Hamilton
Description: Hamilton Company offers one of the most comprehensive selections of chromatography columns in the industry.

Catalog Number: (103006-562)
Supplier: Anaspec Inc
Description: This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Cytiva
Description: HiTrap Q XL are strong anion exchangers prepacked with Q Sepharose XL media, optimized for fast, convenient small-scale protein capture using ion exchange (IEX) chromatography.
Catalog Number: (97001-202)
Supplier: Air-Tite
Description: These bulk syringe caps are very cost-efficient.

Supplier: VWR International
Description: Application specific highly polar phase, ideal for detailed cis/trans FAMEs separation.

Supplier: VWR International
Description: Application specifc column for polycyclic aromatics hydrocarbons.

Supplier: VWR International
Description: Application specifc columns developed for pesticides, herbicides, insecticides analysis and so on.

Supplier: VWR International
Description: High polarity phase, ideal for detailed FAMEs and Dioxins isomers separation.

Supplier: VWR International
Description: Useful for the analysis of chiral compounds in fragrances, pesticides and pharmaceuticals in which the determination of the ratio of enantiomers in a sample is necessary.

Supplier: VWR International
Description: Versatile, general purpose, low-polarity phase for a wide range of applications, including (for example): PCBs, essential oils, pesticides, semivolatiles and many more. HI-5 is a crossbonded phase and assure a long lifetime even under high temperature limits.
Supplier: VWR International
Description: Really versatile general purpose apolar phase for a wide range of applications, including (for example): PCBs, simulated distillation, gases, essential oils, hydrocarbons analysis, pesticides, semivolatiles, oxygenates. HI-1 is a crossbonded phase and assure a long lifetime even under high temperature limits.

Supplier: VWR International
Description: Offering a range of selectivities with differing copolymer rations of PEG and methyl polysiloxane. HI-PLUS, HI-PLUS 10, HI-PLUS 25, HI-PLUS 75, HI-PLUS 90.

Supplier: VWR International
Description: Offering a range of selectivities with differing copolymer rations of PEG and methyl polysiloxane. HI-PLUS, HI-PLUS 10, HI-PLUS 25, HI-PLUS 75, HI-PLUS 90.

Supplier: Avantor
Description: Fingertight fittings, PEEK

Environmentally Preferable

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
753 - 768 of 31,754
no targeter for Bottom