Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-464

Human Protease Activated Receptor 3

Catalog Number: (103007-464)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 6 fragment of the protease-activated receptor 3 (PAR-3). PAR-3 allosterically regulates PAR1 signaling by receptor dimerization governing increased endothelial permeability. Targeting of PAR3 may mitigate the effects of PAR1 in activating endothelial responses such as vascular inflammation. However this peptide does not affect VEGF release or expression.
Sequence: TFRGAP - NH2
MW: 646.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103008-144

[Lys(Me1)12]-Histone H4(1-21)-GGK,Biotin

Catalog Number: (103008-144)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acid residues 1 to 21. It is monomethylated at Lys-12 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Me1)-GGAKRHRKV-GGK(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-238

Human beta-CGRP

Catalog Number: (103008-238)
Supplier: Anaspec Inc
Description: This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-770

CSK tide, FAM (Carboxyfluorescein)

Catalog Number: (103007-770)
Supplier: Anaspec Inc
Description: This is a FAM labeled peptide substrate (Abs/Em = 494/521 nm) for C-terminal Src kinase (Csk) and many other kinases such as Axl, cKit, ERBB4, Fes, Flt3, IGF-1 R, MET, MUSK, PYK2, Ret, TIE2, TrkA, VEGF-R1 and VEGF-R2.
Sequence:5-FAM-KKKKEEIYFFFG-NH2
MW:1921.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102998-444

Human Bradykinin

Catalog Number: (102998-444)
Supplier: Anaspec Inc
Description: This peptide is an inhibitor for Angiotensin I Converting Enzyme (ACE I), derived from Bradykinin. ACE I partially suppresses the renin-angiotensin-aldosterone system (RAAS), which regulates blood pressure and may mediate hypertension. ACE I converts angiotensin I to the biologically active peptide angiotensin II using a zinc- and chloride- dependent mechanism.
Sequence: RPPGFSPFR
MW: 1060.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-476

Bovine Neurotensin Peptide

Catalog Number: (103007-476)
Supplier: Anaspec Inc
Description: This 13 amino acid peptide was first isolated from bovine hypothalamus and was named from its neuronal localization. It was detected in the central nervous system (CNS) and peripheral tissues mainly in the gastrointestinal tract. This bioactive form of neurotensin post-translationally modified at a Glu residue was isolated from porcine intestine.
Sequence:pE-LYENKPRRPYIL
MW:1672.92 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-012

[Lys(Me1)36]-Histone H3 (21-44)-GK,Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 21 to 44 mono-methylated at Lys-36 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2931.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103009-490

Thrombospondin-derived Peptide

Catalog Number: (103009-490)
Supplier: Anaspec Inc
Description: This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. It is cyclized through a disulfide bond. Thrombospondin is a matrix-bound glycoprotein involved in cancer metastasis, tumor adhesion, and angiogenesis. This peptide has been shown to competitively inhibit platelet aggregation and tumor metastasis.
Sequence:CSVTCG (S-S Bonded)
MW:566.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-722

delta PKC (8-17)

Catalog Number: (103008-722)
Supplier: Anaspec Inc
Description: This peptide is derived from the V1 domain of protein kinase C (PKC)d. It inhibits phorbol 12-myristate 13-acetate (PMA)-induced PKCd translocation and activation. Inhibition of PKCd reduces ischemia damage in cardiac and cerebral cells, induces proliferation of fibroblasts, and inhibits graft coronary artery disease in mice.
Sequence:SFNSYELGSL
MW:1116.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-086

[Lys(Me2)4]-Histone H3 (1-21)-GGK,Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 21 di-methylated at Lys-4 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin)
MW:2751.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103008-228

[Lys(Me2)79]-Histone H3 (69-89)-K,Biotin

Catalog Number: (103008-228)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 with amino acid residues 69 to 89 di-methylated at Lys-79 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)
MW:2862.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-448

40Gap 27, Connexin Mimetic

Catalog Number: (103007-448)
Supplier: Anaspec Inc
Description: This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin (Cx40), designated as 40Gap 27. It was used to investigate mechanisms through which oxidant stress impairs communication via gap junctions. When administered, 40Gap27 attenuates endothelium-dependent subintimal smooth muscle hyperpolarization.
Sequence:SRPTEKNVFIV
MW:1289.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-784

HIV Gp91 TAT Peptide 2

Catalog Number: (103007-784)
Supplier: Anaspec Inc
Description: This peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly. It is two amino acid residues shorter at the N-terminus compared with gp91 ds-tat.
Sequence: RKKRRQRRRCSTRIRRQL-NH2
MW: 2453 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-324

PUMA BH3

Catalog Number: (103007-324)
Supplier: Anaspec Inc
Description: This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA together with Bcl-xL, and cytoplasmic p53 coordinate p53 functions. PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53. PUMA may be a direct mediator of p53-induced apoptosis.
Sequence:EEQWAREIGAQLRRMADDLNAQYER
MW:3049.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-450

37,43Gap 27, Connexin Mimetic

Catalog Number: (103007-450)
Supplier: Anaspec Inc
Description: This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-106

Human Cholecystokinin (26-33)

Catalog Number: (102996-106)
Supplier: Anaspec Inc
Description: C-terminal sulfated and amidated octapeptide Cholecystokinin (sulfated CCK-8) has the full biological action of the full-length 33-amino acid long Cholecystokinin (CCK). CCK acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
Sequence: D-Y(SO3H)-MGWMDF-NH2
MW: 1143.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
625 - 640 of 1,860
no targeter for Bottom