You Searched For: ZnAF-1+DA


1,860  results were found

SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Anaspec Inc
Description: This is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis.
Sequence: YGRKKRRQRRR
MW: 1559.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103009-532)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:APRKQLATKAARKSAPATGGVK-GGK(biotin)
MW:2676.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-830)
Supplier: Anaspec Inc
Description: This is a bcl-2 binding peptide. This peptide is derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165.
Sequence:LWAAQRYGRELRRMSDEFEGSFKGL
MW:3003.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-336)
Supplier: Anaspec Inc
Description: [Ala13]-Apelin-13 is an Apelin-13 antagonist evidenced from its blood pressure lowering reversal effects in hypertensive rats.
Sequence:QRPRLSHKGPMPA
MW:1474.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.
Sequence:KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW:4003.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-804)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (102996-368)
Supplier: Anaspec Inc
Description: This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (ABCA_AB145289-5MG)
Supplier: Abcam
Description: ZNAF-2F DA, INTRACELLULAR AB145289-5MG

New Product


Catalog Number: (103005-924)
Supplier: Anaspec Inc
Description: This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.
Sequence:SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
MW:3805.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-234)
Supplier: Anaspec Inc
Description: This is a 9-amino acid peptide corresponding to the C-terminus of bovine rhodopsin. It is widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope.
Sequence:TETSQVAPA
MW:903 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103005-970)
Supplier: Anaspec Inc
Description: A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-358)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-394)
Supplier: Anaspec Inc
Description: This peptide is a fragment of the murine heart muscle specific peptide derived from a-myosin H chain. This peptide was used for induction of autoimmune myocarditis.
Sequence:Ac-RSLKLMATLFSTYASADR
MW:2073.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (ABCA_AB145422-1MG)
Supplier: Abcam
Description: ZNAF-2 DA, FLUORESCENT ZN2 AB145422-1MG

New Product


Catalog Number: (ABCA_AB145422-5MG)
Supplier: Abcam
Description: ZNAF-2 DA, FLUORESCENT ZN2 AB145422-5MG

New Product


Catalog Number: (103007-484)
Supplier: Anaspec Inc
Description: Dyrktide is designed as the optimal substrate sequence efficiently phosphorylated by DYRK1A, which is a dual-specificity protein kinase that is thought to be involved in brain development.
Sequence:RRRFRPASPLRGPPK
MW:1791.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
273 - 288 of 1,860
no targeter for Bottom