Print…

You Searched For: Tricyclic+amide+linker+resin+(DL-form)


43,569  results were found

Refine Results Sort by
SearchResultCount:"43569"

Sort Results

List View Easy View

Rate These Search Results

Product Image-76383-178

Borosil® Tall-Form Graduated Measuring Beakers

Supplier: Foxx Life Sciences
Description: Borosil® tall-form beakers are the ideal container for use when stirring, mixing, or heating liquids.

Product Image-CA101229-746

Chitin Resin, New England Biolabs

Supplier: New England Biolabs (NEB)
Description: An affinity matrix for the isolation of target proteins fused to an intein-chitin binding domain fusion.

Certificates

Image Unavailable-TCM0165-100ML

(±)-α-Methylbenzylamine ≥98.0% (by GC, titration analysis)

Catalog Number: (TCM0165-100ML)
Supplier: TCI America
Description: CAS Number: 618-36-0
MDL Number: MFCD00008069
Molecular Formula: C8H11N
Molecular Weight: 121.18
Purity/Analysis Method: >98.0% (GC,T)
Form: Clear Liquid
Boiling point (°C): 185
Melting point (°C): -65
Flash Point (°C): 69
Specific Gravity (20/20): 0.96

SDS Certificates


Image Unavailable-AA46796-A1

Diaion® SA10A (Cl) 1.3 meq/ml on poly(styrene-divinylbenzene), cross-linked, beads 300 - 1180 µm, strongly basic gel type ion-exchange resin I

Catalog Number: (AA46796-A1)
Supplier: Thermo Scientific Chemicals
Description: Diaion® SA10A(Cl) is an ion exchange resin, cross-linked, strongly basic gel type I, 1.3 meq/ml on PS-DVB.

SDS Certificates


Product Image-75839-724

Cogent Amide™ HPLC Column, MicroSolv Technology Corporation

Supplier: MicroSolv Technology Corp
Description: These useful silica-hydride HPLC columns have an amide functional group bonded directly to the particle with a direct silicon-carbon bond.

Image Unavailable-102999-326

Human Glucagon-Like Peptide 1, GLP-1 amide

Catalog Number: (102999-326)
Supplier: Anaspec Inc
Description: In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4111.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-H-6025.1000BA

Bovine;Guinea pig;Human;Mouse;Rat GLP-1 (1-36) Amide Trifluoroacetate

Supplier: Bachem Americas
Description: For the long-acting GLP-1 analog liraglutide see H-6724.

Product Image-76383-154

Borosil® Low-Form Measuring Beakers

Supplier: Foxx Life Sciences
Description: Ideal for general industry or education laboratory use and a wide variety of other applications. Borosil® low-form beakers are the ideal container for use when stirring, mixing, or heating liquids.

Product Image-10536-518

VWR® Heavy-Duty Low Form Beakers

Supplier: VWR International
Description: These beakers are mechanically stronger than standard beakers and are designed for longer life with increased user safety.

Certificates UL Listed

Image Unavailable-75793-608

Mouse Recombinant Clusterin nuclear form (from E. coli)

Catalog Number: (75793-608)
Supplier: Prosci
Description: Clusterin shares homology with the small heat shock protein family of molecular chaperones. The mature secreted form of the protein is a glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including apoptotic cell death, cell cycle regulation, DNA repair, cell adhesion, tissue remodeling, lipid transportation, membrane recycling, and immune system regulation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.
Product Image-470148-910

High Form Porcelain Crucibles

Supplier: SILICO & CHEMICO PORCELAIN SE
Description: These crucibles are similar to wide-form porcelain crucibles but taller.

Image Unavailable-TCG0061-025G

(±)-2-Pyrrolidinone-5-carboxylic acid ≥99.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 149-87-1
MDL Number: MFCD00064322
Molecular Formula: C5H7NO3
Molecular Weight: 129.12
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 184

SDS Certificates

Image Unavailable-H-3715.0500BA

Human (D-Ala²)-GRF (1-29) amide

Catalog Number: (H-3715.0500BA)
Supplier: Bachem Americas
Description: For sermorelin see H-3705.
Product Image-470015-404

Ward's® Crystal Form Collection

Catalog Number: (470015-404)
Supplier: Avantor
Description: Basic Set of Natural Crystals
Image Unavailable-75793-582

Human Recombinant Clusterin nuclear form (from E. coli)

Catalog Number: (75793-582)
Supplier: Prosci
Description: Clusterin shares homology with the small heat shock protein family of molecular chaperones. The mature secreted form of the protein is a glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including apoptotic cell death, cell cycle regulation, DNA repair, cell adhesion, tissue remodeling, lipid transportation, membrane recycling, and immune system regulation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.
Product Image-470149-482

Flask Form Electroscope

Catalog Number: (470149-482)
Supplier: Shiv Dial Sud & Sons
Description: This inexpensive device detects and estimates charges.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
721 - 736 of 43,569
no targeter for Bottom