Print…

You Searched For: Pyridine+N-oxide


6,227  results were found

Refine Results Sort by
SearchResultCount:"6227"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-366

Human [Met(O)35]-beta-Amyloid (1-42)

Catalog Number: (103007-366)
Supplier: Anaspec Inc
Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-CAAA43799-K2

Pyridine, anhydrous ≥99.5%, ChemSeal™

Supplier: Thermo Scientific Chemicals
Description: Pyridine, anhydrous ≥99.5%, ChemSeal™

Certificates

Product Image-MFLX75810-36

Abaque™ CSM Peristaltic Pump Replacement Hoses

Catalog Number: (MFLX75810-36)
Supplier: VOIGT-ABERNATHY COMPANY, INC
Description: High resistance to oxidants, as well as to concentrated bases and acids.

CE Compliant


Image Unavailable-CAAA40816-14

Germanium-n-butoxide ≥97%

Supplier: Thermo Scientific Chemicals
Description: Applications: Oxide films

Certificates

Image Unavailable-10481-394

Anti-PRDX2 Rabbit Polyclonal Antibody

Catalog Number: (10481-394)
Supplier: Bioss
Description: Peroxiredoxin (Prx) is an antioxidant enzyme detoxifying reactive oxygen species and has a cysteine at the active site. Prx enzymes modulate various receptor signaling pathways and protect cells from oxidatively induced death. Peroxiredoxin 1 to 4 have two conserved Cys residues corresponding to Cys51 and Cys172 of mammalian Peroxiredoxin 1. The active site cysteine(Cys51) is oxidized to cysteine sulfenic acid(Cys51-SOH) when a peroxide is reduced. Because Cys51-SOH is unstable, it forms a disulfide with Cys172-SH which comes from the other subunit of the homodimer. The disulfide is then reduced back to the Prx active thiol form by the thioredoxin-thioredoxin reductase system. However, the formation of the disulfide is a slow process. Thus under oxidative stress conditions, the sulfenic intermediate(Cys51-SOH) can be easily over oxidized to cysteine sulfinic acid(Cys-SO2H) or cysteine sulfonic acid(Cys-SO3H) before it is able to form a disulfide. Recent studies suggest that over oxidized Prx can be reduced back to the active form during recovery after oxidative stress.
Image Unavailable-10481-396

Anti-PRDX2 Rabbit Polyclonal Antibody (Alexa Fluor® 350)

Catalog Number: (10481-396)
Supplier: Bioss
Description: Peroxiredoxin (Prx) is an antioxidant enzyme detoxifying reactive oxygen species and has a cysteine at the active site. Prx enzymes modulate various receptor signaling pathways and protect cells from oxidatively induced death. Peroxiredoxin 1 to 4 have two conserved Cys residues corresponding to Cys51 and Cys172 of mammalian Peroxiredoxin 1. The active site cysteine(Cys51) is oxidized to cysteine sulfenic acid(Cys51-SOH) when a peroxide is reduced. Because Cys51-SOH is unstable, it forms a disulfide with Cys172-SH which comes from the other subunit of the homodimer. The disulfide is then reduced back to the Prx active thiol form by the thioredoxin-thioredoxin reductase system. However, the formation of the disulfide is a slow process. Thus under oxidative stress conditions, the sulfenic intermediate(Cys51-SOH) can be easily over oxidized to cysteine sulfinic acid(Cys-SO2H) or cysteine sulfonic acid(Cys-SO3H) before it is able to form a disulfide. Recent studies suggest that over oxidized Prx can be reduced back to the active form during recovery after oxidative stress.
Image Unavailable-10481-400

Anti-PRDX2 Rabbit Polyclonal Antibody (Alexa Fluor® 555)

Catalog Number: (10481-400)
Supplier: Bioss
Description: Peroxiredoxin (Prx) is an antioxidant enzyme detoxifying reactive oxygen species and has a cysteine at the active site. Prx enzymes modulate various receptor signaling pathways and protect cells from oxidatively induced death. Peroxiredoxin 1 to 4 have two conserved Cys residues corresponding to Cys51 and Cys172 of mammalian Peroxiredoxin 1. The active site cysteine(Cys51) is oxidized to cysteine sulfenic acid(Cys51-SOH) when a peroxide is reduced. Because Cys51-SOH is unstable, it forms a disulfide with Cys172-SH which comes from the other subunit of the homodimer. The disulfide is then reduced back to the Prx active thiol form by the thioredoxin-thioredoxin reductase system. However, the formation of the disulfide is a slow process. Thus under oxidative stress conditions, the sulfenic intermediate(Cys51-SOH) can be easily over oxidized to cysteine sulfinic acid(Cys-SO2H) or cysteine sulfonic acid(Cys-SO3H) before it is able to form a disulfide. Recent studies suggest that over oxidized Prx can be reduced back to the active form during recovery after oxidative stress.
Product Image-10100-394

Anti-ACADVL Rabbit Polyclonal Antibody

Catalog Number: (10100-394)
Supplier: Prosci
Description: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Image Unavailable-10435-140

Anti-4-HNE Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10435-140)
Supplier: Bioss
Description: Aldehydic products of lipid peroxidation, such as 4 hydroxynonenal (4 HNE), have been implicated in the etiology of pathological changes under oxidative stress as a key mediator of oxidative stress induced cell death. It is a stable product of lipid peroxidation, is proarrhythmic and may contribute to the cytotoxic effects of oxidative stress

4-HNE has been hypothesized to play a key role in cell signal transduction, in a variety of pathways from cell cycle events to cellular adhesion.
Product Image-76703-584

Dog Inducible Nitric Oxide Synthase,iNOS ELISA Kit

Catalog Number: (76703-584)
Supplier: AFG Bioscience
Description: Dog Inducible Nitric Oxide Synthase,iNOS ELISA Kit
Product Image-76702-352

Rat Advanced Oxidation Protein Products(AOPP) ELISA Kit

Catalog Number: (76702-352)
Supplier: AFG Bioscience
Description: Rat Advanced Oxidation Protein Products(AOPP) ELISA Kit
Image Unavailable-CAAAAA13348-0E

Diphosphorus pentoxide 98%

Supplier: Thermo Scientific Chemicals
Description: Diphosphorus pentoxide 98%

Certificates

Product Image-470300-150

Aluminum Oxide

Supplier: Ward's Science
Description: CAS Number: 1344-28-1
Formula Weight: 101.96
Formula: Al2O3
Hazard Info: Irritant, Nuisance
Density (g/mL): 3.5
Boiling Point (°C): 2980
Freezing Point (°C): 2050
Solubility: Insoluble in Water, Low solubility in Acids
Synonyms: Alumina, Aluminum Trioxide
Shelf Life (months): 36
Storage: Green

SDS

Image Unavailable-76118-086

Anti-4 Hydroxynonenal Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76118-086)
Supplier: Bioss
Description: Aldehydic products of lipid peroxidation, such as 4 hydroxynonenal (4 HNE), have been implicated in the etiology of pathological changes under oxidative stress as a key mediator of oxidative stress induced cell death. It is a stable product of lipid peroxidation, is proarrhythmic and may contribute to the cytotoxic effects of oxidative stress

4-HNE has been hypothesized to play a key role in cell signal transduction, in a variety of pathways from cell cycle events to cellular adhesion.
Image Unavailable-CAAAH37933-0I

Sand, washed

Supplier: Thermo Scientific Chemicals
Description: Sand, washed

Certificates

Product Image-89061-512

Flow-Thru Ultraviolet Photo-Oxidation Apparatus, Ace Glass

Supplier: Ace Glass
Description: This is a modified version of an Apparatus

Small Business Enterprise Product available on GSA Advantage®

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,121 - 1,136 of 6,227
no targeter for Bottom