Print…

You Searched For: Bis(2-benzamidophenyl)disulfide


2,766  results were found

Refine Results Sort by
SearchResultCount:"2766"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10072-620

Human Recombinant Artemin (from E. coli)

Catalog Number: (10072-620)
Supplier: Prosci
Description: Artemin is a disulfide-linked homodimeric neurotrophic factor structurally related to GDNF, Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. Artemin, GDNF, Persephin and Neurturin all signal through a multicomponent receptor system, composed of RET (receptor tyrosine kinase) and one of the four GFRalpha (alpha1-alpha4) receptors. Artemin prefers the receptor GFRalpha3-RET, but will use other receptors as an alternative. Artemin supports the survival of all peripheral ganglia such as sympathetic, neural crest and placodally derived sensory neurons, and dompaminergic midbrain neurons. The functional human Artemin ligand is a disulfide-linked homodimer, of two 12.0 kDa polypeptide monomers. Each monomer contains seven conserved cysteine residues, one of which is used for interchain disulfide bridging and the others are involved in intramolecular ring formation known as the cysteine knot configuration. Recombinant human Artemin is a 24.2 kDa, disulfide-linked homodimer formed by two identical 113 amino acid subunits.
Product Image-89133-402

Anti-PDI Mouse Monoclonal Antibody

Supplier: Enzo Life Sciences
Description: The mammalian PDI (Protein disulfide-isomerase) family encompasses several highly divergent proteins which are involved in the processing and maturation of secretory proteins in the endoplasmic reticulum by catalyzing the rearrangement of disulfide bonds.

SDS

Product Image-76705-966

Mouse Protein Disulfide-isomerase A4(PDIA4) ELISA Kit

Catalog Number: (76705-966)
Supplier: AFG Bioscience
Description: Mouse Protein Disulfide-isomerase A4(PDIA4) ELISA Kit
Product Image-89348-370

Anti-PDIA3 Rabbit Polyclonal Antibody

Catalog Number: (89348-370)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to ERp57 (protein disulfide isomerase family A, member 3)
Image Unavailable-102998-454

salmon Calcitonin, salmon

Catalog Number: (102998-454)
Supplier: Anaspec Inc
Description: A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-10096-544

Anti-TXNRD3 Rabbit Polyclonal Antibody

Catalog Number: (10096-544)
Supplier: Proteintech
Description: TXNRD3, also named as TGR and TRXR3, belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. TXNRD3 displays thioredoxin reductase, glutaredoxin and glutathione reductase activities. TXNRD3 catalyzes the reaction: Thioredoxin + NADP+ = thioredoxin disulfide + NADPH. TXNRD3 promotes disulfide bond formation between GPX4 and various sperm proteins and may play a role in sperm maturation by promoting formation of sperm structural components.
Image Unavailable-10779-780

Human Recombinant IL-17E (from E. coli)

Supplier: Peprotech
Description: IL-17E is a disulfide-linked homodimer of two 145 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17E stimulates secretion of IL-8, and induces activation of the transcription factor NF-κB in cells that express the IL-17BR receptor. Recombinant Human IL-17E is a 33.8 kDa disulfide-linked homodimer of two 146 amino acid polypeptide chains.

Image Unavailable-10779-804

Human Recombinant IL-17D (from E. coli)

Supplier: Peprotech
Description: IL-17D is a disulfide-linked homodimer of two 185 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17D has the ability to stimulate the production of IL-6, IL-8 and GM-CSF, and inhibits hemopoiesis of myeloid progenitor cells in colony-forming assays. Recombinant Human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains.

Image Unavailable-75790-186

Human Recombinant ER Resident 27 (from Cells)

Catalog Number: (75790-186)
Supplier: Prosci
Description: Endoplasmic reticulum resident protein 27, also known as ER protein 27, C12orf46 and ERP27, is an endoplasmic reticulum luminal protein which is a member of the protein disulfide isomerase family. ERP27 contains one thioredoxin domain and does not contain a CXXC active site motif. ERP27 is widely expressed in many tissues; it has highest expression in pancreas, with lower levels in spleen, lung, kidney, thymus, and bone marrow. ERP27 interacts with PDIA3 and binds somatostatin-14 via hydrophobic interactions. ERP27 may act as a protease, protein disulfide isomerase, thiol-disulfide oxidase or phospholipase.
Image Unavailable-H-6730.0500BA

Human beta-CGRP

Supplier: Bachem Americas
Description: 1mg (Disulfide bond) CAS: 101462-82-2 C162H267N51O48S3 FW: 3793.41 . Synonym: CGRP-II (human)

Image Unavailable-CAAA42943-36

Selenium disulfide 94%

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00011227 Insoluble in water, in dilute HCl

Certificates

Product Image-470302-928

Tin (IV) Chloride 5-Hydrate

Supplier: Ward's Science
Description: CAS Number: 10026-06-9
Formula Weight: 350.58
Formula: SnCl4·5H2O
Density (g/mL): 2.04
Boiling Point (°C): 114
Freezing Point (°C): 53-56
Solubility: Cold Water, Alcohol and Carbon Disulfide
Synonyms: Stannic Chloride, 5-Hydrate
Shelf Life (months): 12
Storage: White

SDS

Product Image-10749-244

Anti-P4HB Rabbit Polyclonal Antibody

Catalog Number: (10749-244)
Supplier: Prosci
Description: PDIA1 (protein disulfide isomerase family A member 1) is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. PDIA1 is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.
Image Unavailable-H-2520.0005BA

(Ser⁴,Ile⁸)-Oxytocin

Supplier: Bachem Americas
Description: For atosiban see H-6722.

Image Unavailable-10781-232

Human Recombinant Neurturin (from E. coli)

Supplier: Peprotech
Description: Neurturin is a disulfide-linked homodimer neurotrophic factor structurally related to GDNF, artemin, and persephin. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Neurturin signals through a multicomponent receptor system, composed of RET and one of four GFRα (α1-α4) receptors. Neurturin promotes the development and survival of sympathetic and sensory neurons by signaling through a receptor system composed of RET and GFRα2. The functional form of human neurturin is a disulfide-linked homodimer, of two 11.8 kDa polypeptide monomers (204 total amino acid residues). Each monomer contains seven conserved cysteine residues, one of which (Cys 69) is used for inter-chain disulfide bridging, and the others are involved in the intramolecular ring formation known as the cysteine knot configuration.

Image Unavailable-10781-310

Human Recombinant Artemin (from E. coli)

Supplier: Peprotech
Description: Artemin is a disulfide-linked homodimeric neurotrophic factor structurally related to GDNF, Artemin, Neurturin and Persephin. These proteins belong to the cysteine knot superfamily of growth factors that assume stable dimeric protein structures. Artemin, GDNF, Persephin and Neurturin all signal through a multicomponent receptor system, composed of RET (receptor tyrosine kinase) and one of the four GFRα (α1-α4) receptors. Artemin prefers the receptor GFRα3-RET, but will use other receptors as an alternative. Artemin supports the survival of all peripheral ganglia, such as sympathetic, neural crest and placodally-derived sensory neurons, and dopaminergic midbrain neurons. The functional human Artemin ligand is a disulfide-linked homodimer of two 12.0 kDa polypeptide monomers. Each monomer contains seven conserved cysteine residues, one of which is used for interchain disulfide bridging and the others are involved in intramolecular ring formation known as the cysteine knot configuration. Recombinant Human Artemin is a 24.2 kDa, disulfide-linked homodimer formed by two identical 113 amino acid subunits.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
145 - 160 of 2,766
no targeter for Bottom