Print…

You Searched For: N-(2,6-Dimethylphenylcarbamoylmethyl)iminodiacetic+acid


69,247  results were found

Refine Results Sort by
SearchResultCount:"69247"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAAA16899-18

Bromophenol blue sodium salt

Supplier: Thermo Scientific Chemicals
Description: Tracking dye for alkaline and neutral buffer systems, for nucleic acid staining

Certificates

Image Unavailable-76082-704

Anti-SIGLEC10 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76082-704)
Supplier: Bioss
Description: SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC10 interacts with PTPN6/SHP-1 upon phosphorylation. The protein is expressed by peripheral blood leukocytes (eosinophils, monocytes and a natural killer cell subpopulation).
Image Unavailable-76082-706

Anti-SIGLEC10 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76082-706)
Supplier: Bioss
Description: SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC10 interacts with PTPN6/SHP-1 upon phosphorylation. The protein is expressed by peripheral blood leukocytes (eosinophils, monocytes and a natural killer cell subpopulation).
Image Unavailable-CAAAAA17951-0J

2-Hydroxypropyl methacrylate (mixture of isomers) 98% stabilized

Supplier: Thermo Scientific Chemicals
Description: 2-Hydroxypropyl methacrylate (mixture of isomers) 98% stabilized

Certificates

Product Image-10088-228

Anti-LIAS Rabbit Polyclonal Antibody

Catalog Number: (10088-228)
Supplier: Proteintech
Description: LIAS(lipoyl synthase, mitochondrial) is also named as LAS and belongs to the radical SAM superfamily and lipoyl synthase family. It produces alpha-lipoic acid, an antioxidant and an essential cofactor in alpha-ketoacid dehydrogenase complexes, which participate in glucose oxidation and ATP generation. The deduced 373-amino acid protein has a calculated molecular mass of about 42 kD. The N-terminal 26 amino acids encode a potential mitochondrial targeting presequence that, upon removal, would result in a deduced mature protein of 347 amino acids with a molecular mass of about 39 kD. Defects in LIAS are a cause of pyruvate dehydrogenase lipoic acid synthetase deficiency (PDHLD).
Image Unavailable-76120-484

Anti-ANKRD26 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76120-484)
Supplier: Bioss
Description: Ankyrins are membrane adaptor molecules that play important roles in coupling integral membrane proteins to the spectrin-based cytoskeleton network. Mutations of ankyrin genes lead to severe genetic diseases such as fatal cardiac arrhythmias and hereditary spherocytosis. ANKRD26 (ankyrin repeat domain-containing protein 26) is a 1709 amino acid protein that contains five ANK repeats. Expressed at high level in many tissues, including brain, liver, kidney and heart, ANKRD26 may be phosphorylated upon DNA damage by Atm or ATR. ANKRD26 is also expressed in the arcuate and ventromedial nuclei within the hypothalamus and in the ependyma and the circumventricular organs that act as an interface between the peripheral circulation and the brain. It is suggested that alterations in the gene encoding ANKRD26 may lead to obesity. Three isoforms of ANKRD26 exists due to alternative splicing events.
Image Unavailable-CA1.01574.1000

Silver sulfate 80 g/L in sulphuric acid (d = 1.84 g/mL) DIN 38409-H43-1 for COD determination according to DIN 38409-41, volumetric solution, Supelco®

Catalog Number: (CA1.01574.1000)
Supplier: MilliporeSigma

SDS


Image Unavailable-76120-482

Anti-ANKRD26 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76120-482)
Supplier: Bioss
Description: Ankyrins are membrane adaptor molecules that play important roles in coupling integral membrane proteins to the spectrin-based cytoskeleton network. Mutations of ankyrin genes lead to severe genetic diseases such as fatal cardiac arrhythmias and hereditary spherocytosis. ANKRD26 (ankyrin repeat domain-containing protein 26) is a 1709 amino acid protein that contains five ANK repeats. Expressed at high level in many tissues, including brain, liver, kidney and heart, ANKRD26 may be phosphorylated upon DNA damage by Atm or ATR. ANKRD26 is also expressed in the arcuate and ventromedial nuclei within the hypothalamus and in the ependyma and the circumventricular organs that act as an interface between the peripheral circulation and the brain. It is suggested that alterations in the gene encoding ANKRD26 may lead to obesity. Three isoforms of ANKRD26 exists due to alternative splicing events.
Image Unavailable-10092-982

Anti-PSMD6 Rabbit Polyclonal Antibody

Catalog Number: (10092-982)
Supplier: Proteintech
Description: The 26 S proteasome is a 2.5-MDa molecular machine that degrades ubiquitinated proteins in eukaryotic cells. It consists of a proteolytic core particle and two 19 S regulatory particles (RPs) composed of 6 ATPase (RPT) and 13 non-ATPase (RPN) subunits. PSMD6 gene encodes 26S proteasome regulatory subunit RPN7, the characteristic of this protein is not well known to date.
Image Unavailable-CAAAJ64630-MA

N-Phthalyl-L-tryptophan ≥99%

Catalog Number: (CAAAJ64630-MA)
Supplier: Thermo Scientific Chemicals
Description: A cell-permeable, specific DNA methyltransferases inhibitor

Certificates


Image Unavailable-CAAAB21096-06

Diethyl (phthalimidomethyl)phosphonate 97%

Supplier: Thermo Scientific Chemicals
Description: Diethyl (phthalimidomethyl)phosphonate 97%

Certificates

Image Unavailable-75791-604

Mouse Recombinant IL1RA (from E. coli)

Catalog Number: (75791-604)
Supplier: Prosci
Description: Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1 beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouse Il1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26% and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in the treatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.
Image Unavailable-102996-422

Human Brain Natriuretic Peptide 32

Supplier: Anaspec Inc
Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Product Image-10096-776

Anti-UMP/CMP kinase Rabbit Polyclonal Antibody

Catalog Number: (10096-776)
Supplier: Proteintech
Description: Pyrimidine nucleoside monophosphate kinase [UMP/CMP kinase (UMP/CMPK)] (CMPK1) is also named as CMK, CMPK, UCK, UMK, UMPK and belongs to the adenylate kinase family. It plays a crucial role in the formation of UDP, CDP, and dCDP, which are required for cellular nucleic acid synthesis. CMPK1 can use a broad spectrum of phosphate donors but the best phosphate donors are ATP and dATP. The longest deduced protein contains 228 amino acids and has a calculated molecular mass of 26 kD. However, translation likely begins at the second initiation methionine, resulting in a protein of 196 amino acids. The shorter form is the endogenously translated protein.
Product Image-10092-120

Anti-PFKFB3 Rabbit Polyclonal Antibody

Catalog Number: (10092-120)
Supplier: Proteintech
Description: PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. It synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5. This antibody is specific to PFKFB3.
Product Image-10092-924

Anti-QDPR Rabbit Polyclonal Antibody

Catalog Number: (10092-924)
Supplier: Proteintech
Description: Dihydropteridine reductase (QDPR), also named as DHPR and HDHPR, is an essential enzyme in the hydroxylating system of the aromatic amino acids, since it catalyses the regeneration of tetrahydrobiopterin (BH4), the natural cofactor of phenylalanine, tyrosine, and tryptophan hydroxylases, from the quininoid-dihydrobiopterin produced in these coupled reactions. The QDPR protein is active as a dimer, with a subunit Mr of 26 kDa. This protein belongs to the short-chain dehydrogenases/reductases (SDR) family. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
337 - 352 of 69,247
no targeter for Bottom