You Searched For: Maleimide


225  results were found

SearchResultCount:"225"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: CAS Number: 220191-36-6
MDL Number: MFCD00142790
Molecular Formula: C18H19NO2S2
Molecular Weight: 345.48
Purity/Analysis Method: >97.0% (HPLC,T)
Form: Crystal
Melting point (°C): 181

SDS

Catalog Number: (89147-138)
Supplier: Enzo Life Sciences
Description: Negative control for the protein kinase C (PKC)-inhibitory activity.


Catalog Number: (CA101447-710)
Supplier: New England Biolabs (NEB)
Description: BG-Maleimide is a thiol-reactive building block for the one-step synthesis of SNAP-tag® substrates from thiol-containing precursors such as thiol-modified oligonucleotides


Catalog Number: (CAPI77164)
Supplier: Thermo Scientific
Description: Imject™ maleimide conjugation buffer (30 mL) is sufficient for dissolving up to 60 mg of sulfhydryl-peptide for maleimide conjugation with carrier proteins.

Supplier: Cytiva
Description: Cy3 and Cy5 monofunctional maleimides are particularly suitable for the selective labeling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides.
Supplier: CUBE BIOTECH
Description: PureCube Maleimide MagBeads are your best option to couple biomolecules that carry thiol (SH) groups.

Catalog Number: (103010-882)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.


Catalog Number: (103011-412)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye.


Catalog Number: (103010-952)
Supplier: Anaspec Inc
Description: Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 C2 maleimide is the longest-wavelength thiol-reactive HiLyte™ Fluor dye currently available.


Catalog Number: (103011-070)
Supplier: Anaspec Inc
Description: QXL® 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores.


Catalog Number: (103010-798)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 647 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dyes.


Catalog Number: (103010-940)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 555 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.


Supplier: CUBE BIOTECH
Description: PureCube maleimide MagBeads XL are your best option to couple biomolecules carrying thiol (SH) groups.

Supplier: Thermo Scientific
Description: Pierce™ Maleimide activated plates are ideal for binding sulfhydryl-containing molecules that are difficult to coat onto polystyrene plates, such as peptides that contain a terminal cysteine. Available in clear for colorimetric assays, white for chemiluminescent assays and black for fluorescent assays.
Catalog Number: (CAPI21102)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce Maleimide-Activated Streptavidin conjugate include streptavidin in a purified form, activated for crosslinking to sulfhydryl groups containing molecules.

Catalog Number: (103007-522)
Supplier: Anaspec Inc
Description: This peptide is HiLyte Fluor 647 labeled Exendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 5486.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
81 - 96 of 225
no targeter for Bottom