You Searched For: Levels


11,446  results were found

SearchResultCount:"11446"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10092-326)
Supplier: Proteintech
Description: UBE2A(Ubiquitin-conjugating enzyme E2 A) serves as the cognate E2-conjugating enzyme. It plays a critical role in regulating TP53 protein levels under both normal and stress conditions. UBE2A, UBE2B regulates TP53 levels in a "yin-yang" manner through a combination of two distinct mechanisms in mammalian cells. This protein has 3 isoforms produced by alternative splicing.


Catalog Number: (102877-350)
Supplier: R&D Systems
Description: The Recombinant Human TGF-beta 1, ACFP Protein from R&D Systems is derived from Sf 9 (baculovirus). The Recombinant Human TGF-beta 1, ACFP Protein has been validated for the following applications: Bioactivity.


Supplier: Contec
Description: Polynit Heatseal Wipes are made of 100% knitted polyester that is laser cut to bond the fibers at the edges of the wipe. This creates a very clean, non-abrasive edge that allows full utilization of the wipe surface.
Supplier: Thermo Fisher Scientific
Description: This cell culture vessel is mounted onto a No.1 borosilicate coverglass
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Omentin is an adipokine that is produced and secreted by the small intestine, visceral adipose tissue, perivascular adipose tissue, and epicardial adipose tissue. Omentin enhances insulin-stimulated glucose uptake in adipocytes and is a link between obesity and Type 2 Diabetes. Omentin also functions as a vasodilator and plays a protective role during coronary atherosclerosis and hypertension.

Catalog Number: (56617-513)
Supplier: Bel-Art Products, a Part of SP
Description: Specifically designed for incubating 1.5 mL microcentrifuge tubes, this rack includes a hold-down disk to maintain a constant pressure on the tube caps and prevent them from opening during internal air expansion.


Catalog Number: (102877-130)
Supplier: R&D Systems
Description: The Recombinant Rat CD44 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Rat CD44 Fc Chimera Protein has been validated for the following applications: Bioactivity.


Catalog Number: (10468-814)
Supplier: Bioss
Description: Together with dynein may be involved in spindle assembly and cytokinesis.Tissue specificity:Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.


Catalog Number: (21924-470)
Supplier: Liberty Industries
Description: These cleanroom wipes are perfect for light to medium duty wiping applications.

Small Business Enterprise


Catalog Number: (10468-822)
Supplier: Bioss
Description: Together with dynein may be involved in spindle assembly and cytokinesis.Tissue specificity:Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.


Catalog Number: (10467-196)
Supplier: Bioss
Description: May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.Tissue specificity: Ubiquitously expressed with higher levels in testis.


Catalog Number: (10467-194)
Supplier: Bioss
Description: May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.Tissue specificity: Ubiquitously expressed with higher levels in testis.


Supplier: Excelta
Description: Ergonomic mini spatulas (oilers) feature a soft, cushioned, and ESD safe (10¹⁰ ohms/sq.) handle.

Supplier: HexArmor
Description: The PointGuard® Ultra 4041 is the only mechanic’s style glove to have both cut and needle-resistance, giving end users superior protection, a performance advantage to keep them safer on the job. Designed with specialized silicone gripping surface on palm.

Catalog Number: (103003-074)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (76100-960)
Supplier: Bioss
Description: Orphan receptor. Displays a significant level of constitutive activity. Its effect is mediated by G(s)-alpha protein that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,441 - 1,456 of 11,446
no targeter for Bottom