You Searched For: Levels


11,445  results were found

SearchResultCount:"11445"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (102867-330)
Supplier: R&D Systems
Description: The Recombinant Human DSPG3 Protein from R&D Systems is derived from NS0. The Recombinant Human DSPG3 Protein has been validated for the following applications: Bioactivity.


Supplier: Microflex
Description: Thick latex gloves are textured for superior grip and provide excellent protection from rips and tears.

Supplier: Restek
Description: Inert, low-bleed columns for reliable column-to-column results from low-level GC/MS analyses provide reproducible retention and selectivity.

Catalog Number: (76100-960)
Supplier: Bioss
Description: Orphan receptor. Displays a significant level of constitutive activity. Its effect is mediated by G(s)-alpha protein that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP.


Catalog Number: (102869-418)
Supplier: R&D Systems
Description: The Recombinant Human Xylulokinase/XYLB Protein from R&D Systems is derived from E. coli. The Recombinant Human Xylulokinase/XYLB Protein has been validated for the following applications: Enzyme Activity.


Catalog Number: (CA10799-102)
Supplier: Superior Glove WorksLtd.
Description: Speckled grey 13-gauge gloves are knit with lint-free, continuous-filament Dyneema®.


Catalog Number: (102869-250)
Supplier: R&D Systems
Description: The Recombinant S. cerevisiae PPA1 Protein from R&D Systems is derived from E. coli. The Recombinant S. cerevisiae PPA1 Protein has been validated for the following applications: Enzyme Activity.


Supplier: Wells Lamont
Description: The Whizard Heavy Duty Armguards II are prewashed and preshrunk for a close fit.

Product available on GSA Advantage®

Catalog Number: (470120-980)
Supplier: Mega Molecules
Description: The Advanced General and Organic Chemistry Molecular Model Set has all of the parts necessary to be successful in a college/university level General or Organic Chemistry course.


Catalog Number: (103003-074)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (10468-814)
Supplier: Bioss
Description: Together with dynein may be involved in spindle assembly and cytokinesis.Tissue specificity:Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.


Supplier: Ergodyne
Description: Supports help reduce the risk of injuries associated with repetitive upper arm movements and strong, forceful grips

Supplier: Cayman Chemical Company
Description: A sensitive detection method for measuring the free acid form of fluprostenol.

Catalog Number: (CAPI23280)
Supplier: Thermo Scientific
Description: Pierce™ Quantitative Peroxide Assay Kit (Aqueous) detects and measures hydrogen peroxide levels in biological samples using an Iron and Xylenol orange* (XO) reagent.

Catalog Number: (10467-194)
Supplier: Bioss
Description: May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.Tissue specificity: Ubiquitously expressed with higher levels in testis.


Catalog Number: (10467-196)
Supplier: Bioss
Description: May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.Tissue specificity: Ubiquitously expressed with higher levels in testis.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,425 - 1,440 of 11,445
no targeter for Bottom