You Searched For: Levels


11,433  results were found

SearchResultCount:"11433"

Sort Results

List View Easy View

Rate These Search Results

Supplier: CHEMOTACTICS, INC MS
Description: Functional biotin labeled human CXCL12a chemokine with very low endotoxin levels.

New Product

Supplier: Mettler Toledo
Description: Accessories for Excellence Plus Level, XP Series Precision Balances, Mettler Toledo

Product available on GSA Advantage®

Supplier: CHEMOTACTICS, INC MS
Description: Recombinant Human CCL4 (MIP-1B) in lyopholized format with very low endotoxin levels.

New Product

Supplier: Enzo Life Sciences
Description: Induces mitochondrial permeability transition (MPT) without requiring elevated Ca2+ levels and thus triggers Fas-mediated apoptosis.

Supplier: Microflex
Description: Add cut resistance to your workers' gloves for tasks that require protection against hand lacerations with the new JACKSON SAFETY® G60 Level 3 Cut Resistant Gloves with Dyneema® fiber coated with polyurethane.

Catalog Number: (10536-426)
Supplier: Abnova
Description: This Set comes with matched Antibody Pair to detect and quantify protein level of human ATP6V1C2.


Supplier: Thermo Scientific
Description: Use performance level 1 Thermo Scientific™ SureSTART™ 2 ml polypropylene screw top microvials for everyday chromatography analysis of <2 ml samples. They provide an affordable choice and can be used with all HPLC/UHPLC instrument types.

Catalog Number: (470137-378)
Supplier: Wards
Description: This sensor takes fast and accurate measurements of the level of free oxygen in air or dissolved oxygen in water.


Supplier: TCI America
Description: Certified by the japan petroleum institute, nitrogen content 0.1mass[perCent] level. ,

SDS

Catalog Number: (103003-074)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (470230-876)
Supplier: Sempco
Description: Teach Elementary-Level Math With Ease!


Catalog Number: (10535-954)
Supplier: Abnova
Description: This Set comes with matched Antibody Pair to detect and quantify protein level of human AGTRAP.


Catalog Number: (10536-812)
Supplier: Abnova
Description: This Set comes with matched Antibody Pair to detect and quantify protein level of human CAMKK1.


Catalog Number: (10536-770)
Supplier: Abnova
Description: This Set comes with matched Antibody Pair to detect and quantify protein level of human CALCOCO2.


Catalog Number: (10536-710)
Supplier: Abnova
Description: This Set comes with matched Antibody Pair to detect and quantify protein level of human C17orf75.


Supplier: NOIR MEDICAL
Description: CE and ANSI certified laser protection eyewear.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
561 - 576 of 11,433
no targeter for Bottom