Print…

You Searched For: Indole-3-carboxylic+acid


33,572  results were found

Refine Results Sort by
SearchResultCount:"33572"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCM2580-1G

6-(Methoxycarbonyl)picolinic acid ≥97.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 7170-36-7
MDL Number: MFCD00806109
Molecular Formula: C8H7NO4
Molecular Weight: 181.15
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 153

SDS

Product Image-CA95046-446

Anti-GS28 Mouse Monoclonal Antibody

Supplier: Enzo Life Sciences
Description: Golgi SNARE of 28 kDa (GS28), also known as p28 or GOS28, is a 28 kDa integral membrane protein on the surface of the Golgi apparatus that serves as a t-SNARE in ER to Golgi transport. The amino-terminal of GS28 is exposed to the cytosol and is anchored to the cis Golgi via a 20 amino acid carboxyl-terminal hydrophobic tail. GS28 co-immunoprecipitates complexes consisting of Syntaxin 5, Rbet1, Membrin, Rsec22, and Rsly1, and is therefore implicated in ER to-Golgi or intra-Golgi vesicle transport.

Image Unavailable-10093-960

Anti-RPS27A Rabbit Polyclonal Antibody

Catalog Number: (10093-960)
Supplier: Proteintech
Description: RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A)
Image Unavailable-10423-848

Anti-PRODH Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10423-848)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-TCT1822-001G

1-(Triisopropylsilyl)indole ≥94.0%

Catalog Number: (TCT1822-001G)
Supplier: TCI America
Description: CAS Number: 123191-00-4
MDL Number: MFCD02093498
Molecular Formula: C17H27NSi
Molecular Weight: 273.50
Purity/Analysis Method: >94.0% (GC)
Form: Clear Liquid
Color: Yellow
Specific Gravity (20/20): 0.99

SDS


Product Image-76333-144

Empore™ Solid Phase Extraction Disks, CDS Analytical

Supplier: CDS ANALYTICAL
Description: Empore SPE disks are a cost-effective and trusted solution in large-volume sample processing for more than 30 years.

Product Image-CA71002-936

HOOK™ Carboxyl Reactive Biotin Reagents & Kits for Highly Efficient Protein Labeling, G-Biosciences

Supplier: G-Biosciences
Description: The use of biotin for non-radioactive labeling of proteins and nucleic acids has now become an increasingly popular technique in life science research

SDS

Image Unavailable-TCP2578-1G

5-Phenyl-5H-pyrido[3,2-b]indole ≥98.0% (by GC)

Supplier: TCI America
Description: 5-Phenyl-5H-pyrido[3,2-b]indole, Purity: >98.0%(GC), CAS Number: 1541200-53-6, Molecular Formula: C17H12N2, Molecular Weight: 244.30, Synonyms: 9-Phenyl- delta -carboline, Size: 200MG

Image Unavailable-CAAAB21672-18

N-Carbobenzoxy-L-proline ≥98%

Supplier: Thermo Scientific Chemicals
Description: N-Carbobenzoxy-L-proline ≥98%

Certificates

Image Unavailable-TCE1068-1G

Ethyl-4,6-dichloronicotinate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 40296-46-6
MDL Number: MFCD00173839
Molecular Formula: C8H7Cl2NO2
Molecular Weight: 220.05
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 85
Melting point (°C): 33

SDS Certificates

Image Unavailable-103009-746

Tau Peptide (337-368) (Repeat 4 Domain)

Catalog Number: (103009-746)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-TCT0177-100G

Thiophene-2-carbonyl chloride ≥99.0% (by titrimetric analysis)

Catalog Number: (TCT0177-100G)
Supplier: TCI America
Description: CAS Number: 5271-67-0
MDL Number: MFCD00005428
Molecular Formula: C5H3ClOS
Molecular Weight: 146.59
Purity/Analysis Method: >99.0% (T)
Form: Clear Liquid
Color: Very Pale Yellow
Boiling point (°C): 190
Flash Point (°C): 90
Specific Gravity (20/20): 1.38

SDS Certificates


Image Unavailable-TCP2322-200MG

3-(Piperidin-4-yl)-1H-indole ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 3-(4-Piperidyl)indole, Purity: >98.0%(GC)(T), Cas number: 17403-09-7, Molecular Formula: C13H16N2, Molecular Weight: 200.29, Synonyms: 4-(3-Indolyl)piperidine, Appearance: Very pale yellow - Pale yellow solid crystal powder, Size: 1G

SDS

Image Unavailable-CAAAAL02212-06

1-Methyl-1H-indole-3-carbaldehyde ≥98%

Supplier: Thermo Scientific Chemicals
Description: 1-Methyl-1H-indole-3-carbaldehyde ≥98%

Certificates

Image Unavailable-TCB3539-1G

(1S,3R)-3-(tert-Butoxycarbonylamino)cyclohexanecarboxylic acid ≥97.0% (by GC, titration analysis)

Catalog Number: (TCB3539-1G)
Supplier: TCI America
Description: CAS Number: 222530-34-9
MDL Number: MFCD06227743
Molecular Formula: C12H21NO4
Molecular Weight: 243.30
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Specific rotation [a]20/D: 50 deg (C=1, MeOH)

SDS


Image Unavailable-89359-522

Anti-RPS6 Rabbit Polyclonal Antibody

Catalog Number: (89359-522)
Supplier: Genetex
Description: 40S ribosomal protein S6 (also known as RPS6) is a ~31 kDa substrate of p70 S6 kinase (p70S6K) and a major component of translational machinery involved in protein synthesis, cell growth, proliferation, and metabolism. RPS6 undergoes phosphorylation on multiple serines in the carboxyl terminal region in the order 236-->235-->240-->244-->247, due to the positions of these amino acid residues on the alpha-helix. Hyperphosphorylation of RPS6 stimulates protein synthesis that mediates progression through the cell cycle.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,201 - 1,216 of 33,572
no targeter for Bottom