You Searched For: Heat+Stress+Meters


10,380  results were found

SearchResultCount:"10380"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76119-556)
Supplier: Bioss
Description: This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X.


Catalog Number: (10393-560)
Supplier: Bioss
Description: May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway. May play a role in hematopoietic lineage decisions and growth regulation.


Catalog Number: (10420-946)
Supplier: Bioss
Description: The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho.


Catalog Number: (10813-728)
Supplier: Prosci
Description: May act as a mediator of stress-activated signals.


Supplier: Chemglass
Description: The cooling and heating coil is made from PFA coated stainless steel and is designed to cool or heat the contents of unjacketed cylindrical reaction vessels.

Small Business Enterprise

Catalog Number: (77461-928)
Supplier: AAT BIOQUEST INC
Description: Red Fluorescence. The Cell Meter™ glucose Uptake imaging kit provides a simple and direct method for quantifying glucose uptake across diverse cellular contexts.


Catalog Number: (10752-362)
Supplier: Antyila Scientific
Description: CMU heating mantles are used in wet chemistry to heat liquids in round bottom flasks


Catalog Number: (10803-336)
Supplier: Restek
Description: A vernier knob will provide smooth and precise tuning for metering gas valves.


Catalog Number: (CA89508-368)
Supplier: Hach
Description: Hach Pocket Pro and Pro+ are engineered to deliver accurate results. Calibration functions for ongoing testing, diagnostics with select models and a stabilized sample lock ensure you get the right reading. You also get replaceable batteries for convenient field use, and a large, easy-to-read LCD screen.


Catalog Number: (75790-346)
Supplier: Prosci
Description: Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma, is a secreted protein which contains 1 C-type lectin domain. It is expressed almost exclusively in the pancreas and also expressed in testis, but not found in small intestine. This protein might be a stress protein involved in the control of bacterial proliferation.


Catalog Number: (10372-062)
Supplier: Bioss
Description: MSK1 is a mitogen and stress activated protein kinase 1 which belongs to the AGC family of kinases and is related in structure to the ribosomal p70 S6 kinase subfamily. MSK1 can be activated by ERK1/2 and SAPK2/p38 MAP kinase. It is also known to be required for the phosphorylation of CREB, ATF1 H3 and HMG14 in response to mitogen and stress. Similar to RSK, MSK1 contains two kinase domains (N term and a C term). Once phosphorylated on Thr581 and Ser360 by ERK1/2 and SAPK2/p38, MSK1 autophosphorylate on at least 5 sites. Of these autophosphorylation sites Ser212 and Ser376 get phosphorylated by the C terminal kinase domain of MSK1 which is essential for the catalytic activity of the N terminal kinase domain.


Catalog Number: (76446-860)
Supplier: VWR International
Description: Ideal for all PCR protocols, these 0.1 and 0.2 ml tubes and caps are made from polypropylene and are compatible with most popular thermal cycler blocks.


Catalog Number: (470005-592)
Supplier: Avantor
Description: Comes with 125 W clear, heat bulb.


Supplier: TMW Media Group
Description: How to help with depression.

Supplier: Anaspec Inc
Description: Neuropeptide Y (NPY) is a 36aa neuropeptide involved in food intake, fat metabolism, stress and pain reduction, and vasodilation
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW:4271.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: EQUIP SOLUTIONS
Description: Optimize performance of your LMI Solenoid Diaphragm Metering Pumps.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,201 - 1,216 of 10,380
no targeter for Bottom