You Searched For: H-Cys(StBu)-OH


7,754  results were found

SearchResultCount:"7754"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76576-264)
Supplier: AFG Bioscience
Description: Human Cystatin D (Cys-D) ELISA Kit, AFG Bioscience


Catalog Number: (CARL600401I05)
Supplier: Rockland Immunochemical
Description: Anti-Rab7 Antibody Detects Human Rab7. Rab7 Is A 207 Amino Acid Transport Carrier, Belonging To The Rab Family Of Ras-Related Gtp-Binding Proteins With 4 Gtp/Gdp-Binding Sites And Terminates In Sequences Such As Cys-X-Cys, Cys-Cys Or A Closely Related Sequence.


Catalog Number: (10782-746)
Supplier: Biosensis
Description: FUNCTION: Involved in redox regulation of the cell. Can reduce hydrogen peroxide and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. May interact with HTR2A. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.


Catalog Number: (102999-606)
Supplier: Anaspec Inc
Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (76704-708)
Supplier: AFG Bioscience
Description: Human Cystatin C(Cys-C) ELISA Kit


Catalog Number: (77525-818)
Supplier: AFG Bioscience
Description: Rabbit Cystatin C (Cys-C) ELISA Kit


Supplier: TCI America
Description: CAS Number: 384842-24-4 MDL Number: MFCD10565627 Molecular Formula: C27H35P Molecular Weight: 390.55 Purity/Analysis Method: <gt/>90.0% (HPLC) Form: Crystal Melting point (°C): 130

SDS

Catalog Number: (N-2005.0500BA)
Supplier: Bachem Americas
Description: Tertiapin Q (TPN Q) shows the same channel-blocking activity as the bee venom peptide tertiapin (N-1745), but increased stability due to the exchange of Met¹³ by Gln.


Catalog Number: (H-1780.0001BA)
Supplier: Bachem Americas
Description: The major physiological roles of Arg-Vasopressin are regulation of water balance in animals (antidiuretic action) and contraction of arterioles (vasopressor action). CAS number (argipressin acetate): 129979-57-3.


Supplier: Thermo Scientific Chemicals
Description: L-Cystine dimethyl ester dihydrochloride, 98%
Supplier: Cytiva
Description: Cy™ fluorescent amidites for incorporation of Cy3, Cy3.5, Cy5, Cy5.5 fluorescent dyes at any position in an oligonucleotide during synthesis.

Catalog Number: (10098-246)
Supplier: Prosci
Description: The MDC gene is one of several Cys-Cys (CC) cytokine genes which are clustered on the q arm of chromosome 16.


Catalog Number: (103006-408)
Supplier: Anaspec Inc
Description: (Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Bachem Americas
Description: Melanin-concentrating hormone (MCH), originally isolated from salmon pituitary glands, has also been found in the mammalian CNS. In lower vertebrates, salmon MCH alters pigmentation by inducing melanosome aggregation within melanocytes of teleost fish, whereas it causes melanosome dispersion in amphibians and reptiles. The biological role of MCH in higher vertebrates, however, is not yet fully understood, but it may function as a neuromodulator and hypophysiotropic agent in the secretion of α-MSH, ACTH, and GH.

Catalog Number: (CA80602-584)
Supplier: MilliporeSigma
Description: Pam₃Cys-Ser-(Lys)₄

Catalog Number: (103871-238)
Supplier: ACROBIOSYSTEMS INC MS
Description: Mouse IFN-alpha 1 Protein, His Tag, ACROBiosystems


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
145 - 160 of 7,754
no targeter for Bottom