You Searched For: Gly-Arg-AMC


2,417  results were found

SearchResultCount:"2417"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Thermo Scientific Chemicals
Description: Hippuric acid 98%
Catalog Number: (G-2180.0005BA)
Supplier: Bachem Americas
Description: Substrate for D-peptidase S, an intracellular carboxypeptidase-like enzyme that preferentially hydrolyzes dipeptides containing hydrophobic D-amino acids.


Catalog Number: (76099-950)
Supplier: Bioss
Description: Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration.


Catalog Number: (103888-120)
Supplier: ACROBIOSYSTEMS INC MS
Description: Human CLEC12A/MICL/CLL-1 Protein, His Tag, PE-Labeled, Source: expressed from human 293 cells (HEK293). It contains AA His 65 - Ala 265, Predicted N-terminus: Gly, protein carries an Avi tag at the N-terminus, followed by a polyhistidine tag, Synonyms: CLEC12A, MICL, CLL-1, CLL1, Size: 25tests


Catalog Number: (102996-446)
Supplier: Anaspec Inc
Description: This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm.
Sequence:vLR-AFC
MW:597.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (TCG0141-100MG)
Supplier: TCI America
Description: CAS Number: 74807-44-6
MDL Number: MFCD00067443
Molecular Formula: C6H12N2O4
Molecular Weight: 176.17
Purity/Analysis Method: >95.0% (T)
Form: Crystal

SDS


Supplier: TCI America
Description: CAS Number: 513-29-1
MDL Number: MFCD00036426
Molecular Formula: C2H5NO2
Molecular Weight: 107.76
Purity/Analysis Method: >98.0% (N,T)
Form: Crystal

SDS

Catalog Number: (103889-630)
Supplier: ACROBIOSYSTEMS INC MS
Description: Human CLEC12A/MICL/CLL-1 Protein, His, Avitag*, Biotinylated, Source: expressed from HEK293. It contains AA His 65 - Ala 265, Predicted N-terminus: Gly, protein carries an Avi tag at N-terminus, followed by a polyhistidine tag, Synonyms: CLEC12A, MICL, CLL-1, CLL1, DCAL2, Size: 200uG


Catalog Number: (103889-666)
Supplier: ACROBIOSYSTEMS INC MS
Description: Human Syndecan-1 Protein, His Tag, FITC-Labeled, Source: expressed from human 293 cells (HEK293). It contains AA Gln 23 - Gly 254, Predicted N-terminus: Gln 23, protein carries a polyhistidine tag at the C-terminus, Synonyms: SDC1, Syndecan-1, CD138, SYND1, SDC, Size: 200uG


Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (CARL200401049)
Supplier: Rockland Immunochemical
Description: Carboxypeptidase B Is A Carboxypeptidase That Preferentially Acts Upon Basic Amino Acids, Such As Arginine And Lysine. This Serum Enzyme Is Also Responsible for Rapidly Metabolizing The C5A Protein Into C5A Des-Arg, With One Less Amino Acid. Host: Rabbit, Species: Bovine


Catalog Number: (76101-380)
Supplier: Bioss
Description: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.


Supplier: TCI America
Description: CAS Number: 2149-70-4
MDL Number: MFCD00007033
Molecular Formula: C6H13N5O4
Molecular Weight: 219.20
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: 24 deg (C=2, 2mol/L Hcl)

SDS

Catalog Number: (H-5936.0005BA)
Supplier: Bachem Americas
Description: LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).


Catalog Number: (10490-490)
Supplier: Bioss
Description: Hemostasis following tissue injury involves the deployment of essential plasma procoagulants (Prothrombin and Factors X, IX, V and VIII), which are involved in a blood coagulation cascade that leads to the formation of insoluble Fibrin clots and the promotion of platelet aggregation. Coagulation Factor X (Stuart Prower factor, FX, F10) is a vitamin K-dependent, single chain serine protease that is synthesized in the liver and circulates as an inactive precursor. The mature form of Factor X (Factor X A) is generated by Factor IX A- or Factor VII A-mediated cleavage at the tripeptide sequence, Arg-Lys-Arg, to yield a disulfide linked dimer. Together with the cofactor Factor V A and Ca2+ on the surface of platelets or endothelial cells, Factor X A coordinates as part of the prothrombinase complex, which mediates proteolysis of Prothrombin into active Thrombin. Mutations at the Factor X locus resulting in Factor X deficiencies can contribute to hemorrhagic diathesis.


Supplier: Thermo Scientific Chemicals
Description: Powder
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,041 - 1,056 of 2,417
no targeter for Bottom