You Searched For: Fmoc-N-Me-Lys(boc)-OH


11,520  results were found

SearchResultCount:"11520"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (TCB4083-5G)
Supplier: TCI America
Description: CAS Number: 53100-44-0
MDL Number: MFCD00672316
Molecular Formula: C10H15NO5
Molecular Weight: 229.23
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 119
Specific rotation [a]20/D: -34 deg (C=1, CHCl3)
Storage Temperature: 0-10°C

SDS


Supplier: Bachem Americas
Description: A very acid sensitive resin suitable for the synthesis of protected peptide fragments by the Fmoc-strategy. ClTrt resin is in particular suitable for the preparation of C-terminal prolyl and cysteinyl peptides (please see 2-Chlorotrityl Chloride Resin-Linked Amino Acids). Release from this resin is achieved by using 1-50 % TFA in CH₂Cl₂ containing 8 % triisopropylsilane, AcOH/CF₃CH₂OH/CH₂Cl₂, 0.5 % TFA or hexafluoroisopropanol/CH₂Cl₂. ClTrt resin has been used in cyclization reactions under Heck reaction conditions, the solid phase synthesis of β-peptides via the Arndt-Eistert homologation of Fmoc-protected amino acid diazoketones and in Mannich reactions of alkynes, secondary amines and aldehydes in the presence of a copper (I) salt affording the corresponding aminomethylalkynyl adducts. 2-Chlorotrityl resin is highly suitable for the synthesis of peptide alcohols, e.g., peptaibols, and peptide ω-aminoalkylamides.

Supplier: Anaspec Inc
Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc
Description: Aß (25-35) is the main factor responsible for Aß neurotoxic effects.

Supplier: TCI America
Description: CAS Number: 42989-85-5
MDL Number: MFCD01632027
Molecular Formula: C7H13NO5
Molecular Weight: 191.18
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 115
Catalog Number: (TCB3251-5G)
Supplier: TCI America
Description: CAS Number: 162046-58-4
Molecular Formula: C13H23NO4
Molecular Weight: 257.33
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal

SDS


Supplier: Bachem Americas
Description: Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).

Supplier: TCI America
Description: CAS Number: 18942-49-9
MDL Number: MFCD00063149
Molecular Formula: C14H19NO4
Molecular Weight: 265.31
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 87
Specific rotation [a]20/D: -25 deg (C=1, EtOH)

SDS

Catalog Number: (TCB2965-5G)
Supplier: TCI America
Description: CAS Number: 62396-48-9
MDL Number: MFCD00798618
Molecular Formula: C9H15NO6
Molecular Weight: 233.22
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Specific rotation [a]20/D: 5.3 deg (C=1, MeOH)

SDS


Supplier: Bachem Americas
Description: Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).

Supplier: TCI America
Description: CAS Number: 75647-01-7
MDL Number: MFCD00065558
Molecular Formula: C9H16N2O5
Molecular Weight: 232.24
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: 7 deg (C=1, DMF)

SDS

Supplier: TCI America
Description: CAS Number: 33125-05-2
MDL Number: MFCD00062043
Molecular Formula: C13H17NO4
Molecular Weight: 251.28
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 91
Specific rotation [a]20/D: -140 deg (C=1, EtOH)
Supplier: TCI America
Description: CAS Number: 70642-86-3
MDL Number: MFCD00063030
Molecular Formula: C14H19NO5
Molecular Weight: 281.31
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Specific rotation [a]20/D: -2 deg (C=2, AcOH)

SDS

Supplier: Bachem Americas
Description: Substrate V, Mca-RPPGFSAFK(Dnp), is a very sensitive internally quenched fluorescent substrate for endothelin-converting enzyme-1 (ECE-1) a membrane-bound zinc metallopeptidase that is related to neprilysin in amino acid sequence. The kcat/Km value for the hydrolysis by ECE-1 was 1.9 x 10⁷ M⁻¹s⁻¹ and 1.7 x 10⁶ M⁻¹s⁻¹ for the hydrolysis by neprilysin. This FRET substrate was hydrolyzed rapidly by stromelysin 1 (MMP-3) with kcat/Km= 218000 M⁻¹s⁻¹ and very slowly by gelatinase B (MMP-9) (kcat/Km= 10100 M⁻¹s⁻¹). There was no hydrolysis by MMP-1 and MMP-2. Mca-RPPGFSAFK(Dnp) has also found use as substrate for insulin-degrading enzyme (IDE) and ACE2.

Supplier: TCI America
Description: CAS Number: 13726-85-7
MDL Number: MFCD00065571
Molecular Formula: C10H18N2O5
Molecular Weight: 246.26
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -4 deg (C=2, EtOH)
Supplier: TCI America
Description: CAS Number: 16937-99-8
MDL Number: MFCD00038294
Molecular Formula: C11H21NO4
Molecular Weight: 231.29
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 88
Specific rotation [a]20/D: 25 deg (C=2, AcOH)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,041 - 1,056 of 11,520
no targeter for Bottom