You Searched For: Fmoc-Cys(Trt)


3,831  results were found

SearchResultCount:"3831"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CA603145126)
Supplier: Rockland Immunochemical
Description: Secondary Antibody for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug


Catalog Number: (CA603141126)
Supplier: Rockland Immunochemical
Description: Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates 100ug


Catalog Number: (CA605745125)
Supplier: Rockland Immunochemical
Description: Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug


Catalog Number: (CA610745124)
Supplier: Rockland Immunochemical
Description: Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug


Supplier: Anaspec Inc
Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Thermo Scientific Chemicals
Description: N-Boc-S-methyl-L-cysteine 96%
Supplier: Thermo Scientific Chemicals
Description: Crystalline powder
Catalog Number: (10111-072)
Supplier: Prosci
Description: Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL13 displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.


Supplier: MilliporeSigma
Catalog Number: (CA95040-042L)
Supplier: Cytiva
Description: ECL Plex Cy-conjugated Antibodies are part of an optimized system for quantitative analysis using fluorescent western blotting.

Catalog Number: (CA610742124)
Supplier: Rockland Immunochemical
Description: Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug


Catalog Number: (CA611744127)
Supplier: Rockland Immunochemical
Description: Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug


Catalog Number: (CA611742127)
Supplier: Rockland Immunochemical
Description: Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug


Catalog Number: (76414-944)
Supplier: Biotium
Description: Cyanine 555-dUTP can be used to synthesize labeled DNA probes for in-situ hybridization, microarray or blotting techniques.


Catalog Number: (A-3650.0001BA)
Supplier: Bachem Americas
Description: Sequence: Boc-Pen(NPys)-OH


Supplier: Bachem Americas
Description: Potent inhibitor of the Ras farnesyltransferase (Ftase) with an IC₅₀ of 50 nM. It prevented farnesylation of Ras and resulted in its inability to associate with other cell signaling components at the interior of the plasma membrane microenvironment.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
241 - 256 of 3,831
no targeter for Bottom