Print…

You Searched For: Fluorescein-5-maleimide


16,253  results were found

Refine Results Sort by
SearchResultCount:"16253"

Sort Results

List View Easy View

Rate These Search Results

Product Image-CAPI22713

Pierce™ Pegylation Reagents, Methyl-PEG-NHS-Maleimide, Thermo Scientific

Supplier: Thermo Scientific
Description: Pierce™ MM(PEG)<sub>n</sub> reagents are methyl-terminated PEG compounds activated with a maleimide group for covalent pegylation of sulfhydryls on proteins or assay surfaces.

Certificates

Product Image-CAPI28100

PMPI (4-Maleimidophenyl isocyanate), Pierce™

Catalog Number: (CAPI28100)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce PMPI is a maleimide-and-isocyanate crosslinker for attaching compounds to sulfhydryl groups (cysteines) after conjugating the linker to hydroxyl groups on a molecule by urethane (carbamate) bonds.
Product Image-CAPI22323

BMOE (bis-Maleimidoethane), Pierce™

Catalog Number: (CAPI22323)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce BMOE is a short-arm, maleimide crosslinker for covalent, irreversible conjugation between sulfhydryl groups (e.g., protein or peptide cysteines).

Certificates


Product Image-89139-724

Reactive Biotin Compounds, Biotium

Supplier: Biotium
Description: Biotinylation reagents with a variety of reactive functional groups.

Product Image-RL200-303-382

Anti-6xHis Mouse Monoclonal Antibody (HRP (Horseradish Peroxidase)) [clone: 39A1413]

Catalog Number: (RL200-303-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide
Product Image-RL200-306-382

Anti-6xHis Mouse Monoclonal Antibody (Biotin) [clone: 14A231]

Catalog Number: (RL200-306-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.
Product Image-RL200-345-382

Anti-6xHis Mouse Monoclonal Antibody (DyLight® 800) [clone: 33D1.D2]

Catalog Number: (RL200-345-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.
Product Image-CA95017-553L

Amersham Cy3 and Cy5 Maleimide Mono-Reactive Dye 5-Packs, Cytiva

Supplier: Cytiva
Description: Mono-functional maleimides are particularly suitable for the selective labelling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides.

SDS Certificates

Image Unavailable-CAPI77605

Imject™ Pierce™ Maleimide-Activated Carrier Proteins, Thermo Scientific

Supplier: Thermo Scientific
Description: Imject<sup>® </sup>Maleimide-activated mcKLH and PEGylated mcKLH enable conjugation of sulfhydryl-containing peptide haptens to elicit an immune response and antibody production against the hapten

Certificates

Product Image-89147-134

3,4-Di(1H-indol-3-yl)-1H-pyrrole-2,5-dione ≥98%

Supplier: Enzo Life Sciences
Description: PKC inhibitor

Image Unavailable-103007-522

Gila C2 maleimide)-Exendin-4, HiLyte™ Fluor 647

Catalog Number: (103007-522)
Supplier: Anaspec Inc
Description: This peptide is HiLyte Fluor 647 labeled Exendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 5486.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102999-616

Human Cys-beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Product Image-RL200-343-382

Anti-6xHis Mouse Monoclonal Antibody (DyLight® 649) [clone: 33D1.D2]

Catalog Number: (RL200-343-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.
Product Image-RL200-344-382

Anti-6xHis Mouse Monoclonal Antibody (DyLight® 680) [clone: 33D1.D2]

Catalog Number: (RL200-344-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was prepared by repeated immunizations of mice with a synthetic peptide corresponding to the 6X HIS epitope tag (H-H-H-H-H-H) conjugated to KLH using maleimide.
Product Image-RL200-342-382

Anti-6xHis Mouse Monoclonal Antibody (DyLight® 549) [clone: 33D1.D2]

Catalog Number: (RL200-342-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.
Image Unavailable-Q-2680.0500BA

5(6)-TAMRA

Supplier: Bachem Americas
Description: Sequence: 5(6)-Carboxy-tetramethylrhodamine
Synonym(s): 5(6)-TAMRA

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
97 - 112 of 16,253
no targeter for Bottom