You Searched For: 2-Ethylcaproic+acid

Supplier: Bachem Americas

Description: 6-FAM-D(OMe)E(OMe)VD(OMe)-FMK (methyl ester of FAM-DEVD-FMK) is a cell-permeable, non-toxic inhibitor that binds irreversibly to activated caspase-3 in apoptotic cells. The fluorescence intensity can be measured by flow cytometry, microwell plate reader, or fluorescence microscopy.

Supplier: Microflex

Description: Powder-free, latex-free gloves provide the protection of nitrile with sensitivity comparable to natural rubber latex.

Catalog Number: (77101-392)

Supplier: Optimize

Description: OPTI-LOK Fittings are ideal for high-pressure connections with ¹/₁₆" OD tubing. All Optimize fittings are precision machined for optimal quality and thread consistency and are designed for trouble-free operation at pressures of up to 6,000 psi.

Supplier: Bachem Americas

Description: Sequence: 5-Carboxy-fluorescein
Synonym(s): 5-FAM#4-(6-Hydroxy-3-oxo-3H-xanthen-9-yl)-isophthalic acid

Catalog Number: (103007-290)

Supplier: Anaspec Inc

Description: This renin FRET peptide is a specific substrate for rat renin. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by rat renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. The SensoLyte® 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (76264-396)

Supplier: Kemtech America

Description: With sealed-in glass disc of listed porosity.

Supplier: Microflex

Description: Nitrile gloves offer excellent tactile sensitivity and dexterity as well as superior fit and comfort.

Catalog Number: (102996-396)

Supplier: Anaspec Inc

Description: This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-200)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: O&M HALYARD CANADA, INC CA

Description: Designed for use in laboratories, research environments, and clean areas with applications in pharmaceutical, medical device manufacturing, biotechnology, and food processing/handling.

Supplier: O&M HALYARD CANADA, INC CA

Description: Designed for use in laboratories, research environments, and clean areas with applications in pharmaceutical, medical device manufacturing, biotechnology, and food processing/handling.

Certificates

Catalog Number: (103005-940)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-3 and 12 activities, Abs/Em = 494/521nm.
Sequence:5-FAM-RPKPVE-Nva-WRK(QXL™ 520)-NH2
MW:2143.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-434)

Supplier: Anaspec Inc

Description: This is a 5-FAM-labeled Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor. Livin prevents apoptosis and sensitizes Livin-expressing cells to chemotherapy. This peptide has the potential to be used as a therapeutic agent in cancer treatment.
Sequence:AVPIAQKSEK-K(5-FAM)-NH2
MW:1555.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.

Catalog Number: (103006-568)

Supplier: Anaspec Inc

Description: This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement system is a central component of host defense but can also contribute to the inflammation seen in pathological conditions. The C1s protease of the C1 complex initiates the host defense pathway. This peptide employs 5FAM/QXL520 FRET pair for quantitation of complement enzyme activity.
Sequence:5-FAM-SLGRKIQIK(QXL 520)-NH2
MW:2019.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-626)

Supplier: Anaspec Inc

Description: Enterokinase is a heterodimeric serine protease produced by cells in the duodenal wall