Print…

You Searched For: Methyl+Indole-2-carboxylate


12,501  results were found

Refine Results Sort by
SearchResultCount:"12501"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-76085-300

Anti-CYP24A1 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76085-300)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-75835-376

Grob DA 280 Column Test Mix (11 components), Restek

Catalog Number: (75835-376)
Supplier: Restek
Description: Contains: n-decane, C10, 280 µg/ml, methyl decanoate, C10:0, 420 µg/ml, n-undecane, C11, 280 µg/ml, methyl undecanoate, C11:0, 420 µg/ml, methyl dodecanoate, C12:0, 420 µg/ml, L(+)-2,3-butanediol, 530 µg/ml, 2,6-dimethylaniline, 320 µg/ml, 2,6-dimethylphenol, 320 µg/ml, 2-ethylhexanoic acid, 380 µg/ml, nonanal, 400 µg/ml, 1-octanol, 360 µg/ml.
Image Unavailable-103007-214

Human [Lys22]-beta-Amyloid (1-40)

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-10072-222

Mouse Recombinant FGF basic (from E. coli)

Supplier: Prosci
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant rat FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues. Recombinant murine FGF-basic is a 16.2 kDa protein consisting of 145 amino acid residues.

Image Unavailable-10483-434

Anti-DCAF11 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10483-434)
Supplier: Bioss
Description: WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids that commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms concerning chromatin assembly, cell cycle control, signal transduction, RNA processing, apoptosis and vesicular trafficking. WDR23 (WD-repeat-containing protein 23), also known as GL014 or PRO2389, is a 546 amino acid protein that contains seven WD-repeats. WDR23 is expressed as three isoforms due to alternative splicing events.
Image Unavailable-10777-994

Human Recombinant KGF (from E. coli)

Supplier: Peprotech
Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF (FGF-7) is a mitogen factor specific for epithelial cells and keratinocytes. KGF (FGF-7) signals through FGFR 2b. KGF (FGF-7) plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF (FGF-7) is an 18.9 kDa protein consisting of 163 amino acid residues.

Image Unavailable-CA1.01647.0500

Alcian blue solution used in nuclear staining, for histology, Sigma-Aldrich®

Catalog Number: (CA1.01647.0500)
Supplier: MilliporeSigma
Description: Used to stain acidic mucosubstances

SDS Certificates


Image Unavailable-103006-666

Rat Atrial Natriuretic Peptide (4-18)

Catalog Number: (103006-666)
Supplier: Anaspec Inc
Description: This peptide corresponds to amino acids 4 to 18 of rat atrial natriuretic peptide (ANP). It has been used as a cystein containing peptide model in quantitative mass spectroscopic analysis. This fragment is also related to C-ANP (4-23);  (Des-Gln18,des-Ser19,des-Gly20,22,des-Leu21), which is completely selective in discriminating rat C-AMP receptors.
Sequence:RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
MW:1594.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-10771-958

Human Recombinant KGF (from E. coli)

Supplier: Peprotech
Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF (FGF-7) is a mitogen factor specific for epithelial cells and keratinocytes. KGF/FGF-7 signals through FGFR 2b. KGF (FGF-7) plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF (FGF-7) is an 18.9 kDa protein consisting of 163 amino acid residues.

Image Unavailable-10781-864

Mouse Recombinant FGF-basic (from E. coli)

Supplier: Peprotech
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Murine FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues.

Image Unavailable-TCV0043-025ML

Sodium vinylsulfonate 25% ∼2.3 mol/L in water

Supplier: TCI America
Description: CAS Number: 3039-83-6
MDL Number: MFCD00007520
Molecular Formula: C2H4O3S
Molecular Weight: 130.09
Form: Clear Liquid
Color: Very Pale Yellow
Melting point (°C): -20

SDS Certificates

Product Image-10751-600

Anti-VKORC1 Rabbit Polyclonal Antibody

Catalog Number: (10751-600)
Supplier: Prosci
Description: VKORC1 Antibody: Vitamin K epoxide reductase complex subunit 1 (VKORC1) is the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form which is essential for blood clotting. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is VKORC1 that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance.
Image Unavailable-75810-768

Calcium stearate FCC

Supplier: Spectrum Chemicals
Description: CALCIUM STEARATE, FCC, also known as E470, is used as a flow agent in powders. The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.

Image Unavailable-75811-382

Hydrochloric acid 37% FCC

Supplier: Spectrum Chemicals
Description: Hydrochloric Acid, 37 Percent, FCC is used in food processing, or as a food additive to adjust the pH. The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.

Certificates

Image Unavailable-10774-776

Mouse Recombinant FGF-basic (from E. coli)

Supplier: Peprotech
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Murine FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues.

Image Unavailable-10072-040

Mouse Recombinant FGF Basic (from E. coli)

Supplier: Prosci
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant human FGF-basic is a 17.2 kDa protein consisting of 154 amino acid residues. Recombinant murine FGF-basic is a 16.2 kDa protein consisting of 145 amino acid residues.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
705 - 720 of 12,501
no targeter for Bottom