Print…

You Searched For: Dodecanal+dimethyl+acetal


4,684  results were found

Refine Results Sort by
SearchResultCount:"4684"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCA1535-001G

Acetic acid (1S,2R)-2-[N-Benzyl-N-(mesitylenesulfonyl)amino]-1-phenylpropyl ester ≥98.0% (by HPLC)

Catalog Number: (TCA1535-001G)
Supplier: TCI America
Description: [Reagent for double aldol reaction]
CAS Number: 240423-53-4
MDL Number: MFCD02093425
Molecular Formula: C27H31NO4S
Molecular Weight: 465.61
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 121

SDS


Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Product Image-CA11012-776

Whatman™ Cellulose Acetate Membrane Filters

Supplier: Cytiva
Description: Cytiva's Whatman cellulose acetate membrane filters have very low protein binding, which minimizes sample loss when filtering protein-based aqueous samples.

Certificates

Product Image-RC5032

Acetate Buffer solutions, pH 4.00, Ricca Chemical Company

Supplier: Ricca Chemical
Description: Acetate buffer, pH 4.0, for residual chlorine analysis

SDS Certificates Small Business Enterprise

Product Image-CA14909-32

Acetate Buffer Solution, pH 4.0, 100 mL, Hach

Catalog Number: (CA14909-32)
Supplier: Hach
Description: Acetate Buffer Solution, pH 4.0
Image Unavailable-CA76517-530

Cellulose Acetate Membrane Filters

Supplier: Sartorius
Description: Cellulose Acetate (CA) membrane filters are highly suited for pressure filtration devices.

Product Image-IC0976401C2

Acetate Plate Sealer, Nonsterile, MP Biomedicals

Catalog Number: (IC0976401C2)
Supplier: MP Biomedicals
Description: Acetate plate sealer is easy to apply and remove from microplates. In addition, this microplate sealing tape is suitable for all microplates for both short and long term storage, providing a tight seal to minimize evaporation and condensation.

Certificates


Product Image-470300-530

Calcium Acetate Monohydrate

Supplier: Ward's Science
Description: CAS Number: 5743-26-0
Formula Weight: 176.18
Formula: Ca(CH3CO2)2·H2O
Density (g/mL): 0.3
Boiling Point (°C): Decomposes
Synonyms: Lime Acetate, Calcium Diacetate
Shelf Life (months): 12
Storage: Green

SDS

Product Image-RC55-5

Acetate Buffer, pH 4.5, Ricca Chemical Company

Catalog Number: (RC55-5)
Supplier: Ricca Chemical
Description: 0.4359 Molar sodium acetate buffer adjusted with acetic acid to pH 4.5

SDS Certificates Small Business Enterprise


Product Image-470161-656

Acetate Sheet, 8 1/2×11" Each

Catalog Number: (470161-656)
Supplier: xpedx
Description: Acetate Sheet, 8 1/2 x 11" Each<BR><BR>Please Note: This product is designed for educational and teaching laboratories and no certificate of analysis is available.
Image Unavailable-TCA1534-001G

Acetic acid (1R,2S)-2-[N-Benzyl-N-(mesitylenesulfonyl)amino]-1-phenylpropyl ester ≥98.0% (by HPLC)

Catalog Number: (TCA1534-001G)
Supplier: TCI America
Description: [Reagent for double aldol reaction]
CAS Number: 240423-74-9
MDL Number: MFCD02093424
Molecular Formula: C27H31NO4S
Molecular Weight: 465.61
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 121

SDS


Product Image-470300-176

Ammonium Acetate

Supplier: Ward's Science
Description: CAS Number: 631-61-8
Formula Weight: 77.09
Formula: CH3COONH4
Hazard Info: Irritant
Density (g/mL): 1.07
Boiling Point (°C): Decomposes
Freezing Point (°C): 114
Solubility: Water and Alcohol
Synonyms: Acetic Acid Ammonium Salt
Shelf Life (months): 12
Storage: Green

SDS

Image Unavailable-SXS-3204

Propyl Acetate Single-Component Organic Standard, SPEX CertiPrep

Catalog Number: (SXS-3204)
Supplier: SPEX CERTIPREP LLC
Description: Single-Component organic standards.
Image Unavailable-SXS-3893

Methyl acetate Single-Component Organic Standard, SPEX CertiPrep

Catalog Number: (SXS-3893)
Supplier: SPEX CERTIPREP LLC
Description: Single-Component organic standards.
Product Image-CA71007-232

Ethanol denatured ≥80% (denatured with methanol and ethyl acetate)

Catalog Number: (CA71007-232)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: (DAG-2A)

SDS Certificates


Product Image-CAMKH30105

Perchloric acid 0.10 N in glacial acetic acid, StandARd® volumetric solution, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Perchloric acid 0.10 N in glacial acetic acid, StandARd® volumetric solution, Macron Fine Chemicals™

Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,473 - 1,488 of 4,684
no targeter for Bottom