Print…

You Searched For: DISTRIBUTION+RESULTS,+INC.


50,626  results were found

Refine Results Sort by
SearchResultCount:"50626"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103003-364

Human hBD-1

Catalog Number: (103003-364)
Supplier: Anaspec Inc
Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-CA76049-286

SiliaFlash® Irregular Silica Gels, SiliCycle Inc

Supplier: SiliCycle
Description: SiliaFlash® products are ideal for both analytical and preparative chromatography, from laboratory to pilot-plant processes and production scales.

SDS

Image Unavailable-103003-366

Human hBD-3

Catalog Number: (103003-366)
Supplier: Anaspec Inc
Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
MW:5155.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-97049-930

YMC-Triart C18 Hybrid Silica HPLC Columns; C18, 5 µm, SemiPrep/Preparative, YMC America

Supplier: YMC America,Inc
Description: YMC-Triart C18, 5 µm semi-preparative and preparative columns are packed with a novel, organic/inorganic hybrid silica particles derivatized with C18. Triart C18 columns feature chemical stability and mechanical strength, operation over a wide pH range of 1 to 12, high loading capacity, narrow particle and pore size distributions, and the ability to operate in 100% aqueous environments. Triart C18 5 µm semi-preparative and preparative columns are available in many column geometries.

Image Unavailable-102996-314

Human;Pig;Rat Viasoactive intestinal peptide

Supplier: Anaspec Inc
Description: 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-103010-674

Staphylococcus aureus Recombinant Sortase (from E. coli)

Catalog Number: (103010-674)
Supplier: Anaspec Inc
Description: Sortases are a family of membrane–anchored transpeptidases expressed by Gram–positive bacteria. Sortase A catalyzes the cleavage of C-terminal recognition motif (LPXTG) of multiple structurally unrelated proteins followed by formation of an amide bond with the peptidoglycan layer of the bacteria. Since Sortases are widely distributed among a variety of bacterial pathogens and required for virulence, Sortases represent a promising therapeutic target for the development of novel anti-infective agents. In addition, Sortase A can be used as a biotechnology tool for a variety of protein modifications and immobilization by sortase-mediated protein ligation.
Image Unavailable-103002-994

Interphotoreceptor Retinoid Binding Protein Fragment

Catalog Number: (103002-994)
Supplier: Anaspec Inc
Description: This peptide corresponds to human keratin K18 amino acids 26-38, with an additional C-terminal cysteine. The sequence is identical to mouse K18 except that human K18 Val28 is replaced by alanine in the mouse sequence. Members of the 14-3-3 protein family bind the human intermediate filament protein keratin 18 (K18) in-vivo, in a cell-cycle- and phosphorylation-dependent manner. K18 Ser33 phosphorylation is essential for the association of K18 with 14-3-3 proteins and plays a role in keratin organization and distribution.
Sequence:RPVSSAApSVYAGAC
MW:1418.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-VF-B483036E

VWR® Modular Workstations, W×D×H 48×30×36"

Supplier: VWR International
Description: VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.

Product Image-VF-B723030F

VWR® Modular Workstations, W×D×H 72×30×30"

Supplier: VWR International
Description: VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.

Product Image-VF-B483030P

VWR® Modular Workstations, W×D×H 48×30×30"

Supplier: VWR International
Description: VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.

Image Unavailable-VF-B723036F

VWR® Modular Workstations, W×D×H 72×30×36"

Supplier: VWR International
Description: VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.

Image Unavailable-VF-U723036PB

VWR® Modular Workstations with Upper Support, W×D×H 72×30×36"

Supplier: VWR International
Description: VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.

Image Unavailable-VF-U723030P

VWR® Modular Workstations with Upper Support, W×D×H 72×30×30"

Supplier: VWR International
Description: VWR® modular work benches are designed for a wide range of applications in laboratory and industrial environments including biotech, pharmaceutical, analytical, material handling, distribution, and assembly.

Image Unavailable-75841-986

Anti-CD45.1 Mouse Monoclonal Antibody [clone: A20]

Catalog Number: (75841-986)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 antibody reacts with mouse CD45.1, also known as Ly5.1, which is a strain-specific allelic form of the CD45 Leukocyte Common Antigen (LCA). Functionally, CD45 is a protein tyrosine phosphatase whose broad cell distribution supports a critical role in many leukocyte functions, including regulation of signal transduction and cell activation associated with the T cell and B cell receptors. The A20 antibody is typically used as a leukocyte marker in Ly5.1 mouse strains: SJL/J, DA, STS/A and RIII. The antibody has been demonstrated to specific for CD45.1 and is not cross-reactive with CD45.2 bearing cells.
Product Image-AGG4556-80102

CrossLab Instrument Supplies for GC, Agilent Technologies

Supplier: AGILENT TECHNOLOGIES, INC (CSD)
Description: Maintain your GC system with Agilent supplies for optimal results.

Product Image-50809-020

VWR® Inoculating Turntables

Supplier: VWR International
Description: Hand-operated inoculating turntables produce almost concentric circles of bacterial colonies evenly distributed across Petri dishes.

Product available on GSA Advantage®

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
97 - 112 of 50,626
no targeter for Bottom