Print…

You Searched For: Chromeazurol+S+(Mordant+blue+29)


23,177  results were found

Refine Results Sort by
SearchResultCount:"23177"

Sort Results

List View Easy View

Rate These Search Results

Product Image-97061-738

Coomassie® brilliant blue R-250, Ultrapure

Supplier: VWR
Description: Commonly used stain for the detection of protein bands following electrophoresis.

SDS Certificates

Image Unavailable-76109-592

Anti-Connexin-29 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76109-592)
Supplier: Bioss
Description: Connexin 29 belongs to the connexin family and is a member of the epsilon-type subfamily. Connexin 29 is a membrane bound, multi-pass protein also known as gap junction epsilon-1 protein. A connexon, consisting of connexin hexamers, is a membrane bound structure that is integral in the formation of a gap junction. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. Connexin 29 expression is restricted to the central nervous system and is present in brain, spinal cord, and sciatic nerve samples. It has been suggested that connexin 29 in the mature CNS contributes minimally to gap junctional intercellular communication in oligodendrocyte cell bodies. Rather, connexin 29 is targeted to myelin where it, along with connexin 32, may contribute to connexin-mediated communication between adjacent layers of uncompacted myelin.
Image Unavailable-TCP0449-500G

Piperazine citrate hydrate ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 144-29-6
MDL Number: MFCD00038961
Molecular Formula: C4H10N2
Molecular Weight: 642.66
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 185

SDS

Image Unavailable-TCA0829-025G

1-(Carbamoylmethyl)pyridinium chloride ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 41220-29-5
MDL Number: MFCD00032002
Molecular Formula: C7H9ClN2O
Molecular Weight: 172.61
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 213

SDS

Image Unavailable-TCS0046-25G

Cresol red sodium salt

Supplier: TCI America
Description: CAS Number: 62625-29-0
MDL Number: MFCD00001618
Molecular Formula: C21H18O5S
Molecular Weight: 404.41
Form: Crystal
Color: Deep Yellow Red

SDS Certificates

Product Image-76416-090

Accessories for Vortex Mixers, TX4, ZX3, RX3, ZX4, CLASSIC and WIZARD, VELP Scientifica

Catalog Number: (76416-090)
Supplier: VELP SCIENTIFIC INC.
Description: Shaker, Vortex Mixer, Foam stand for 4 tubes, Ø 29 mm
Image Unavailable-TCH0159-5G

DL-Homocysteine ≥90.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 454-29-5
MDL Number: MFCD00004898
Molecular Formula: C4H9NO2S
Molecular Weight: 135.18
Purity/Analysis Method: >90.0% (T)
Form: Crystal
Melting point (°C): 233
Flash Point (°C): 110

SDS Certificates

Image Unavailable-TCB0459-025G

1,2-Diphenylethane ≥99.0%

Supplier: TCI America
Description: CAS Number: 103-29-7
MDL Number: MFCD00004796
Molecular Formula: C14H14
Molecular Weight: 182.27
Purity/Analysis Method: >99.0% (GC)
Form: Crystal
Boiling point (°C): 284
Melting point (°C): 52
Flash Point (°C): 129

SDS Certificates

Product Image-97061-692

Bromophenol blue ACS

Supplier: VWR
Description: Bromophenol blue ACS

SDS Certificates

Image Unavailable-102996-320

Human Growth Hormone Releasing Factor, GRF (1-29), amide

Supplier: Anaspec Inc
Description: This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-89263-506

Anti-CCT epsilon (chaperonin containing TCP1 Subunit 5 (epsilon)) Rat Monoclonal Antibody [clone: PK/29/23/8d]

Catalog Number: (89263-506)
Supplier: Genetex
Description: Rat monoclonal antibody [PK/29/23/8d] to CCT epsilon
Product Image-10788-904

Human Recombinant IL-29 (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Interleukin 29 (IL-29), also known as IFN-λ, is a type III interferon produced by virally infected cells. IL-29 plays an important role in host defenses against microbes and antiviral activity. IL-29 shares homology with interleukin 28 (IL-28) and binds the class II cytokine receptor IL-28R.

Product Image-76701-282

Rat Cancer Antigen 27-29 (CA 27-29) ELISA Kit

Catalog Number: (76701-282)
Supplier: AFG Bioscience
Description: Rat Cancer Antigen 27-29 (CA 27-29) ELISA Kit
Product Image-470300-736

Citric Acid Anhydrous

Catalog Number: (470300-736)
Supplier: Ward's Science
Description: CAS Number: 77-92-9
Density: 1.665 g/mL
Freezing Point: 153 °C
Solubility: Water, Alcohol and Ether
Synonyms: Propane Tricarboxylic Acid
Shelf Life: 12 Mouths

SDS


Product Image-97063-702

Trypan blue 0.4% in aqueous solution ready-to-use, sterile

Catalog Number: (97063-702)
Supplier: VWR
Description: A pre-mixed dye solution used in cell culture applications to determine cell viability. A researcher can remove a sample of cells from culture and combine in a 1:1 ratio with the Trypan Blue solution. Under the microscope, dead cells will appear a blue color and viable cells will appear clear and translucent. Using a hemacytometer (gridded microscope slide), a researcher can quantify the percentage of dead cells within a population. Stained cells are ready for counting within five minutes.

SDS Certificates Product available on GSA Advantage®


Image Unavailable-TCC1353-001G

4-Carboxyphenylboronic acid (contains varying amounts of Anhydride)

Supplier: TCI America
Description: CAS Number: 14047-29-1
MDL Number: MFCD00151801
Molecular Formula: C7H7BO4
Molecular Weight: 165.94
Form: Crystal
Color: White

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
113 - 128 of 23,177
no targeter for Bottom