Print…

You Searched For: Cbz-Ser(Bzl)-OH


8,848  results were found

Refine Results Sort by
SearchResultCount:"8848"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-H-6825.0025BA

Human;Mouse H-Tyr-Ile-Gly-Ser-Arg-OH Trifluoroacetate

Supplier: Bachem Americas
Description: The pentapeptide YIGSR located within domain III of the laminin B1 chain, represents a major receptor binding site in laminin. By competing with laminin for the cell surface receptor, the short peptide is able to inhibit cell attachment to basement membranes, thus preventing the formation of tumor metastases. YIGSR also promotes tumor cell migration and, moreover, mediates the adhesion of a variety of epithelial cells to laminin.

Image Unavailable-102996-884

S6 Kinase Substrate (229-239)

Supplier: Anaspec Inc
Description: This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103003-134

Crosstide Peptide, FAM (Carboxyfluorescein)

Catalog Number: (103003-134)
Supplier: Anaspec Inc
Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Image Unavailable-102996-536

Human beta-Endorphin

Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-288

Dby HY Peptide

Catalog Number: (103006-288)
Supplier: Anaspec Inc
Description: Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.
Sequence:NAGFNSNRANSSRSS
MW:1568.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102997-488

AKT/PKB/Rac-Protein Kinase Substrate, AnaSpec

Supplier: Anaspec Inc
Description: The native peptide ARKRERTYSFGHHA (29944-1) is a synthetic substrate for AKT/PKB/Rac-protein kinases. Phophorylation is at the Ser site (Km = 3.9 µM). It also competitively inhibits histone H2B phosphorylation (Ki = 12 µM) by AKT.
Sequence:Biotin-ARKRERTYSFGHHA
MW:1942.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-B-3440.0005BA

Fmoc-Ile-Thr(Psi(Me,Me)pro)-OH

Catalog Number: (B-3440.0005BA)
Supplier: Bachem Americas
Description: These dipeptide building blocks containing Ser- or Thr-derived oxazolidines (pseudoprolines) proved to be versatile tools for overcoming some intrinsic problems in the field of peptide chemistry. The presence of pseudoprolines within a peptide sequence results in the disruption of β-sheet structures considered as a source of intermolecular aggregation during chain elongation, thus increasing solvation and coupling kinetics in peptide assembly. Therefore, use of pseudoprolines offer new possibilities for accessing large peptides by convergent strategies and chemoselective ligation techniques. Moreover, incorporation of a pseudoproline unit facilitates cyclization of peptides.
Image Unavailable-103003-190

CREBtide

Catalog Number: (103003-190)
Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPSYR
MW:1717 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-184

RGDS

Catalog Number: (103008-184)
Supplier: Anaspec Inc
Description: The short peptide RGDS (Arg-Gly-Asp-Ser) is a synthetic cell adhesion factor. RGDS is known to mediate cell adhesion to several extracellular matrix components as well as cell–cell interactions. The RGDS peptide has been shown to interact directly with and activates caspases 8 and 9, which indicates an unexpected pro-apoptotic effect due to an intracellular action.
Sequence:RGDS
MW:433.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-M-1510.0025BA

Kemptide Trifluoroacetate

Supplier: Bachem Americas
Description: Kemptide, LRRASLG, is a synthetic peptide substrate corresponding to part of the phosphorylation site sequence in porcine liver pyruvate kinase. Kemptide is phosphorylated in vitro and in vivo by cAMP-dependent protein kinase and in vitro by protein kinase C.

Image Unavailable-H-2095.0500BA

Human Atrial Natriuretic Factor 1-28 Trifluoroacetate

Supplier: Bachem Americas
Description: ANP/ANF is synthesized in cardiac myocytes and is primarily released in response to atrial wall stretching and intravascular volume expansion. The peptide signals via the guanylate cyclase-linked natriuretic peptide receptor A (NPR-A) and plays an important role in blood pressure regulation and blood volume homeostasis. ANP/ANF exerts vasodilatory, diuretic, natriuretic, anti-inflammatory, antifibrotic and antimitogenic effects. As BNP, ANP stimulates lipolysis in adipocytes. Millucci et al. studied the aggregation behavior of αANP, which may play a role in congestive heart failure.

Image Unavailable-H-1156.0025BA

Ac-Ser-Asp-Lys-Pro-OH

Supplier: Bachem Americas
Description: The bioactive tetrapeptide goralatide which corresponds to the N-terminus of Thymosin β₄, is a physiological regulator of hematopoiesis and inhibits the entry into the S-phase of murine and human hematopoietic stem cells. Ac-SDKP has been shown to reduce the damage to specific compartments in the bone marrow resulting from treatment with chemotherapeutic agents, ionizing radiations, hyperthermy, or phototherapy. It protects from doxorubicin-induced toxicity. Ac-SDKP is a physiological substrate of angiotensin I- converting enzyme (ACE).

Image Unavailable-M-2420.0001BA

Mca-(Asn⁶⁷⁰,Leu⁶⁷¹)-Amyloid beta/A4 Protein Precursor₇₇₀ (667-675)-Lys(Dnp) Acetate

Catalog Number: (M-2420.0001BA)
Supplier: Bachem Americas
Description: Fluorogenic (FRET) substrate for pro-memapsin-2 containing the β-secretase site of the Swedish mutation of APP, SEVNLDAEF.
Image Unavailable-103003-706

Human;Mouse;Rat Beta-Amyloid (25-35)

Supplier: Anaspec Inc
Description: Aß (25-35) is the main factor responsible for Aß neurotoxic effects.

Image Unavailable-H-7358.0500BA

Human Hepcidin-20 Trifluoroacetate

Supplier: Bachem Americas
Description: Hepcidin-20, a degradation product of hepcidin-25 found in plasma and urine, shows an increased antimicrobial activity compared to the full-length peptide, but it is not involved in iron metabolism.

Image Unavailable-102996-334

GRGDSP Peptide

Supplier: Anaspec Inc
Description: An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
321 - 336 of 8,848
no targeter for Bottom