Print…

You Searched For: 3-Methylbenzofuran-2-carboxylic+acid


65,966  results were found

Refine Results Sort by
SearchResultCount:"65966"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CA80055-790

Amphotericin B, Millipore®

Catalog Number: (CA80055-790)
Supplier: MilliporeSigma
Description: A polyene antifungal antibiotic that nonspecifically induces loss of low molecular weight substances from cells

Certificates


Image Unavailable-10073-016

Human Recombinant Cdnf (from E. coli)

Catalog Number: (10073-016)
Supplier: Prosci
Description: CDNF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote survival, growth and function of dopamine specific neurons. CDNF and its structural homolog MANF, each contain an N-terminal saposin-like lipid binding domain, and a carboxyl-terminal domain, which is not homologous to previously characterized protein structures. CDNF and MANF can prevent 6-OHDA induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson disease. Recombinant human CDNF is an 18.5 kDa protein consisting of 162 amino acids including 8 cysteine residues.
Image Unavailable-TCC1730-25G

N-Carbobenzyloxy-D-proline ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 6404-31-5
MDL Number: MFCD00063228
Molecular Formula: C13H15NO4
Molecular Weight: 249.27
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 76
Specific rotation [a]20/D: 40 deg (C=2, EtOH)

SDS

Product Image-10090-028

Anti-MCCC2 Rabbit Polyclonal Antibody

Catalog Number: (10090-028)
Supplier: Proteintech
Description: MCCC2(Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial) is also named as MCCB and belongs to the AccD/PCCB family. The putative 563-amino acid polypeptide has a calculated molecular mass of 61 kD and contains an N-terminal mitochondrial targeting sequence. It catalyzes carboxylation of 3 methylcrotonyl COA to form 3 methylglutaconyl-COA and is probably a dodecamer composed of six biotin-containing alpha subunits and six beta subunits. Defects in MCCC2 are the cause of methylcrotonoyl-CoA carboxylase 2 deficiency (MCC2D).
Image Unavailable-10781-200

Human Recombinant CDNF (from E. coli)

Supplier: Peprotech
Description: CDNF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote survival, growth and function of dopamine-specific neurons. CDNF and its structural homolog, MANF, each contain an N-terminal saposin-like lipid binding domain, and a carboxyl-terminal domain, which is not homologous to previously characterized protein structures. CDNF and MANF can prevent 6-OHDA-induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson’s disease. Recombinant Human CDNF is an 18.5 kDa protein consisting of 162 amino acids, including 8 cysteine residues.

Image Unavailable-10771-124

Yeast Recombinant Kex-2 (from Hi-5 Insect Cells)

Supplier: Peprotech
Description: Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at, or adjacent to, specific residues, or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes, including prenatal and postnatal development, reproduction, signal transduction, immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, as they are frequently used in the analysis and production of proteins. Kex-2 cleaves at the carboxyl end of the recognition sequences Arg-Arg/X and Lys-Arg/X. Recombinant Yeast Kex-2 is a 60.4 kDa protease consisting of 558 amino acid residues.

Image Unavailable-103009-746

Tau Peptide (337-368) (Repeat 4 Domain)

Catalog Number: (103009-746)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-TCE0954-25G

1-Boc-DL-nipecotic acid ethyl ester ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 130250-54-3
MDL Number: MFCD04116274
Molecular Formula: C13H23NO4
Molecular Weight: 257.33
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 93
Melting point (°C): 37

SDS

Product Image-CA95046-446

Anti-GS28 Mouse Monoclonal Antibody

Supplier: Enzo Life Sciences
Description: Golgi SNARE of 28 kDa (GS28), also known as p28 or GOS28, is a 28 kDa integral membrane protein on the surface of the Golgi apparatus that serves as a t-SNARE in ER to Golgi transport. The amino-terminal of GS28 is exposed to the cytosol and is anchored to the cis Golgi via a 20 amino acid carboxyl-terminal hydrophobic tail. GS28 co-immunoprecipitates complexes consisting of Syntaxin 5, Rbet1, Membrin, Rsec22, and Rsly1, and is therefore implicated in ER to-Golgi or intra-Golgi vesicle transport.

Image Unavailable-TCN0828-5G

4-Nitrobenzyl-(2S,4S)-2-(dimethylcarbamoyl)-4-mercapto-1-pyrrolidinecarboxylate ≥95.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 96034-64-9
MDL Number: MFCD08063348
Molecular Formula: C15H19N3O5S
Molecular Weight: 353.39
Purity/Analysis Method: >95.0% (HPLC,T)
Form: Crystal
Melting point (°C): 119
Specific rotation [a]20/D: 9 deg (C=1, CHCl3)

SDS Certificates

Image Unavailable-CAAAJ61491-03

Amphotericin B

Supplier: Thermo Scientific Chemicals
Description: Amphotericin B, antifungal activity has been used against leishmaniasis caused by protozoan parasites of the Leishmania genus.

Certificates

Image Unavailable-TCA2092-5G

Ampicillin trihydrate ≥98.0% (by HPLC, titration analysis)

Catalog Number: (TCA2092-5G)
Supplier: TCI America
Description: CAS Number: 7177-48-2
MDL Number: MFCD00072036
Molecular Formula: C16H19N3O4S
Molecular Weight: 349.41
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 202
Specific rotation [a]20/D: 293 deg (C=0.5, H2O)
Storage Temperature: 0-10°C

Certificates


Image Unavailable-103004-984

Human Recombinant alpha-Synuclein (from E. coli), HiLyte Fluor® 488

Catalog Number: (103004-984)
Supplier: Anaspec Inc
Description: The recombinant human a-synuclein (1-140) (GenBank Accession # NP_000336) was expressed and purified from E. coli and conjugated with the fluorescence dye HiLyte FluorTM 488. This protein is produced without affinity tag.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.
Image Unavailable-TCE1068-1G

Ethyl-4,6-dichloronicotinate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 40296-46-6
MDL Number: MFCD00173839
Molecular Formula: C8H7Cl2NO2
Molecular Weight: 220.05
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 85
Melting point (°C): 33

SDS Certificates

Image Unavailable-10781-208

Human Recombinant MANF (from E. coli)

Supplier: Peprotech
Description: MANF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote the survival, growth and function of dopamine-specific neurons. MANF and its structural homolog CDNF each contain an N-terminal, saposin-like, lipid-binding domain, and a carboxyl-terminal domain that is not homologous to previously characterized protein structures. MANF and CDNF can prevent 6-OHDA-induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson's disease. Recombinant Human MANF is an 18.1 kDa protein consisting of 158 amino acids, including 8 cysteine residues.

Image Unavailable-89359-522

Anti-RPS6 Rabbit Polyclonal Antibody

Catalog Number: (89359-522)
Supplier: Genetex
Description: 40S ribosomal protein S6 (also known as RPS6) is a ~31 kDa substrate of p70 S6 kinase (p70S6K) and a major component of translational machinery involved in protein synthesis, cell growth, proliferation, and metabolism. RPS6 undergoes phosphorylation on multiple serines in the carboxyl terminal region in the order 236-->235-->240-->244-->247, due to the positions of these amino acid residues on the alpha-helix. Hyperphosphorylation of RPS6 stimulates protein synthesis that mediates progression through the cell cycle.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,105 - 1,120 of 65,966
no targeter for Bottom