You Searched For: 3,6-Dibromopyridazine


4,462  results were found

SearchResultCount:"4462"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: CAS Number: 40649-36-3
MDL Number: MFCD00058690
Molecular Formula: C9H16O
Molecular Weight: 140.23
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 98
Flash Point (°C): 86
Specific Gravity (20/20): 0.91
Supplier: Bachem Americas
Description: This C-terminal fragment was shown to suppress the noradrenaline release from sympathetic nerve endings. It thereby mimics the effects of PYY and NPY at presynaptic (Y₂) receptors. The peptide was also able to compete with NPY for essentially all binding sites in rat brain.

Supplier: Dickies
Description: Dickies® style 2053.

Supplier: Thermo Fisher Scientific
Description: 36-position sliding drawer rack holds 36 Thermo Scientific Tube Boxes; 3.365W x 5.03L x 1.082"H; fits 490L (17.3 cu. ft.) and 651L (23 cu. ft.), 4 Inner Door freezers

Catalog Number: (470236-306)
Supplier: VWR International
Description: Gamma sterilized bags make sample collection quick and easy.

Catalog Number: (TCB0704-500ML)
Supplier: TCI America
Description: CAS Number: 71-36-3
MDL Number: MFCD00002964
Molecular Formula: C4H10O
Molecular Weight: 74.12
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 118
Melting point (°C): -90
Flash Point (°C): 37
Specific Gravity (20/20): 0.81

Supplier: TCI America
Description: CAS Number: 5337-36-0
MDL Number: MFCD00027295
Molecular Formula: C18H39BO3
Molecular Weight: 314.32
Purity/Analysis Method: >98.0% (T)
Form: Clear Liquid
Boiling point (°C): 311
Flash Point (°C): 149
Specific Gravity (20/20): 0.85

Supplier: Ace Glass
Description: Heavy-wall, borosilicate glass tubes are designed for polymerization and analysis of halogens by thermal decomposition in the presence of lime

Small Business Enterprise Product available on GSA Advantage®

Catalog Number: (470093-354)
Supplier: EATON OFFICE SUPPLY
Description: Invisible tape, roll, with the dimension of ³/₄" × 36 yards.


Catalog Number: (76733-648)
Supplier: ANTIBODIES.COM LLC
Description: Human Apelin 36 ELISA kit is a competitive Enzyme-Linked Immunosorbent Assay (cELISA) designed for the <i>in vitro</i> quantitative determination of human Apelin 36 in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (75794-080)
Supplier: Prosci
Description: IL-36alpha (IL-1F6), IL-36beta (IL-1F8) and IL-36gamma (IL-1F9) bind to IL-36R (IL-1Rrp2) and IL-1RAcP, activating similar intracellular signals as IL-1. IL-36Ra inhibits the production of proinflammatory cytokines, including IL-12, IL-1beta, IL-6, TNF-alpha and IL-23 induced by IL-36 in BMDC and CD4 T cells. Skin and dendritic cells are targets of the IL-36 interleukins leading to a Th1 response. These cytokines may represent potential targets for immune-mediated inflammatory conditions or, alternatively, could be used as adjuvants in vaccination.


Catalog Number: (89214-742)
Supplier: VWR International
Description: Boxes are constructed of durable fiberboard with a protective, moisture-repellant coating.

Small Business Enterprise


Supplier: HiMedia
Description: The HiVeg™ line of products consists of uniquely formulated, 100% vegetable-based media designed to work in conjunction with or replace standard animal-based protein sources.

Catalog Number: (102996-408)
Supplier: Anaspec Inc
Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: DuPont
Description: DuPont™ ProShield® 10, spunbond meltblown spunbond (SMS) garments, are made to the high quality standards you have come to expect from DuPont.

Supplier: Dickies
Description: Style 18007 designed with classic triple-needle stitching for durability and 5-Piece pocket bib with durable zip closure and flap closure pocket entry.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
305 - 320 of 4,462
no targeter for Bottom