Print…

You Searched For: 3,6-Dibromo-9-n-octylcarbazole


4,829  results were found

Refine Results Sort by
SearchResultCount:"4829"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCM1834-1G

4-Methoxyphenyl-4-O-acetyl-3,6-di-O-benzyl-2-deoxy-2-phthalimido-β-D-glucopyranoside ≥98.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 140615-77-6
Molecular Formula: C37H35NO9
Molecular Weight: 637.69
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Specific rotation [a]20/D: 85 deg (C=0.8, CHCl3)
Storage Temperature: 0-10°C

SDS

Image Unavailable-TCD2324-010G

2,2-Dibromo-1,3-diphenyl-1,3-propanedione ≥98.0% (by titrimetric analysis)

Catalog Number: (TCD2324-010G)
Supplier: TCI America
Description: CAS Number: 16619-55-9
MDL Number: MFCD00068642
Molecular Formula: C15H10Br2O2
Molecular Weight: 382.05
Purity/Analysis Method: >98.0% (T)
Form: Crystal

SDS


Image Unavailable-76219-608

2,5-Bis(2-ethylhexyl)-3,6-di(2-thienyl)-2,5-dihydropyrrolo[3,4-c]pyrrole-1,4-dione ≥98.0% (by HPLC)

Catalog Number: (76219-608)
Supplier: TCI America
Description: 2,5-Bis(2-ethylhexyl)-3,6-di(2-thienyl)-2,5-dihydropyrrolo[3,4-c]pyrrole-1,4-dione, Purity: >98%, CAS: 1185885-86-2, MF: C30H40N2O2S2, MW: 524.78, Form: Crystal- Powder, Yellow - Deep yellow red, Size: 200MG
Image Unavailable-TCD3969-5G

3,6-Di(2-thienyl)-2,5-dihydropyrrolo[3,4-c]pyrrole-1,4-dione ≥95.0% (by HPLC, total nitrogen)

Supplier: TCI America
Description: CAS Number: 850583-75-4
Molecular Formula: C14H8N2O2S2
Molecular Weight: 300.35
Purity/Analysis Method: >95.0% (HPLC,N)
Form: Crystal

SDS Certificates

Image Unavailable-TCD0595-025G

3,6-Dihydroxynaphthalene-2,7-disulfonic acid disodium salt ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 7153-21-1
MDL Number: MFCD00004090
Molecular Formula: C10H8O8S2
Molecular Weight: 364.25
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal

SDS

Image Unavailable-TCB4062-25MG

N-(1R,8S,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane ≥90.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 1263166-93-3
MDL Number: MFCD19705418
Molecular Formula: C17H28N2O4
Molecular Weight: 324.42
Purity/Analysis Method: >90.0% (HPLC)
Form: Clear Liquid
Storage Temperature: >-20°C

SDS

Image Unavailable-TCD1710-005G

5,5-Dibromo-2,2-dimethyl-1,3-dioxane-4,6-dione (5,5-Dibromomeldrum's acid) ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 66131-14-4
MDL Number: MFCD00059808
Molecular Formula: C6H6Br2O4
Molecular Weight: 301.92
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 75
Storage Temperature: <0°C

SDS

Image Unavailable-TCL0115-025G

(3S)-(-)-cis-3,6-Dimethyl-1,4-dioxane-2,5-dione ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 4511-42-6
MDL Number: MFCD00070594
Molecular Formula: C6H8O4
Molecular Weight: 144.13
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 97
Flash Point (°C): 200
Specific rotation [a]20/D: -290 deg (C=1, Toluene)

SDS Certificates

Image Unavailable-103008-696

Human GLP-1(9-36), amide

Catalog Number: (103008-696)
Supplier: Anaspec Inc
Description: GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-H-8585.0500BA

Human Peptide YY (3-36) Trifluoroacetate

Supplier: Bachem Americas
Description: PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity.

Image Unavailable-TCB4357-1G

3,6-Dihydro-2H-pyridine-1-carboxylic acid tert-butyl ester ≥97.0% (by GC)

Catalog Number: (TCB4357-1G)
Supplier: TCI America
Description: 1-tert-Butoxycarbonyl-1,2,3,6-tetrahydropyridine, Purity: >97.0%(GC), Cas: 85838-94-4, Molecular Formula: C10H17NO2, MW: 183.25, Synonyms: 1-Boc-1,2,3,6-tetrahydropyridine, tert-Butyl 1,2,3,6-Tetrahydropyridine-1-carboxylate, Size: 1G

SDS


Image Unavailable-102996-562

Human Peptide YY (3-36)

Supplier: Anaspec Inc
Description: This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.
Sequence:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4049.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Product Image-76576-438

Human Interleukin-36 (IL-36) ELISA Kit, AFG Bioscience

Catalog Number: (76576-438)
Supplier: AFG Bioscience
Description: Human Interleukin-36 (IL-36) ELISA Kit, AFG Bioscience
Product Image-RK30270

1,2-Dibromo-3-Chloropropane (DBCP), Restek

Catalog Number: (RK30270)
Supplier: Restek
Description: 2000ug/mL. Solvent: Purge and Trap Grade Methanol. Packaged 1mL/ampule.

SDS


Image Unavailable-103006-340

Human Apelin-36

Catalog Number: (103006-340)
Supplier: Anaspec Inc
Description: This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.
Sequence:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
MW:4195.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-H-3208.0500BA

Human;Mouse;Rat (Tyr³⁶)-pTH-Related Protein (1-36)

Supplier: Bachem Americas
Description: (Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
321 - 336 of 4,829
no targeter for Bottom